spacer

EBI Dbfetch

ID   FJ668016; SV 1; linear; genomic DNA; STD; HUM; 237 BP.
XX
AC   FJ668016;
XX
DT   09-APR-2009 (Rel. 100, Created)
DT   30-AUG-2009 (Rel. 102, Last updated, Version 2)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*1501 new
DE   allele, exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-237
RX   DOI; 10.1111/j.1399-0039.2009.01295.x.
RX   PUBMED; 19523021.
RA   Alaez C., Munguia A., Garcia D., Gomez K., Gorodezky C.;
RT   "DRB1*1532, a new DR15 allele, identified in a Mexican unrelated donor from
RT   Veracruz, Mexico";
RL   Tissue Antigens 74(3):267-268(2009).
XX
RN   [2]
RP   1-237
RA   Alaez C., Munguia A., Garcia D., Gomez K., Gorodezky C.;
RT   ;
RL   Submitted (29-JAN-2009) to the INSDC.
RL   Department of Immunology and Immunogenetics, Instituto de Diagnostico y
RL   Referencia Epidemiologicas, Carpio 470 1st Floor, Mexico, DF 11340, Mexico
XX
DR   MD5; 6a7b96008922045fa8462e05d98ffc35.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..237
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>237
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1501 new"
FT   mRNA            <1..>237
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1501 new"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>237
FT                   /codon_start=1
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1501 new"
FT                   /product="MHC class II antigen"
FT                   /note="HLA class II histocompatibility antigen"
FT                   /db_xref="GOA:C1JJS3"
FT                   /db_xref="IMGT/HLA:DRB1*15:32"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:C1JJS3"
FT                   /protein_id="ACO50427.1"
FT                   /translation="RECHFFNGTERVRFLDRYFYNQEETVRFDSDVGEFRAVTELGRPD
FT                   AEYWNSQKDILEQARAAVDTYCRHNYGVVESFTV"
FT   exon            <1..>237
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1501 new"
FT                   /number=2
XX
SQ   Sequence 237 BP; 50 A; 56 C; 90 G; 41 T; 0 other;
     agggagtgtc atttcttcaa tgggacggag cgggtgcggt tcctggacag atacttctat        60
     aaccaggagg agaccgtgcg cttcgacagc gacgtggggg agttccgggc ggtgacggag       120
     ctggggcggc ctgacgctga gtactggaac agccagaagg acatcctgga gcaggcgcgg       180
     gccgcggtgg acacctactg cagacacaac tacggggttg tggagagctt cacagtg          237
//


spacer
spacer