Dbfetch

ID   FJ655417; SV 1; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   FJ655417;
XX
DT   03-MAR-2009 (Rel. 100, Created)
DT   21-JAN-2010 (Rel. 103, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-Cw) gene, HLA-Cw*04 variant allele,
DE   exons 2, 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RX   DOI; 10.1111/j.1399-0039.2009.01398.x.
RX   PUBMED; 20196822.
RA   Thude H., Michael M., Loth M., Schorner U., Barz D.;
RT   "Identification of the novel allele Cw*040110 in a German patient";
RL   Tissue Antigens 75(1):80-82(2010).
XX
RN   [2]
RP   1-646
RA   Thude H., Michael M., Loth M., Schorner U., Haertel M., Barz D.;
RT   ;
RL   Submitted (22-JAN-2009) to the INSDC.
RL   University Hospital Jena, Institute for Transfusion Medicine, Erlanger
RL   Allee 101, Jena, Thueringen 07747, Germany
XX
DR   MD5; 56bae83fd9e3e4a6a7e0758d5818bae6.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>646
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*04 variant"
FT   mRNA            join(<1..270,371..>646)
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*04 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,371..>646)
FT                   /codon_start=3
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*04 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="IMGT/HLA:C*04:01:10"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:C0L3D7"
FT                   /protein_id="ACN29697.1"
FT                   /translation="SHSMRYFSTSVSWPGRGEPRFIAVGYVDDTQFVRFDSDAASPRGE
FT                   PREPWVEQEGPEYWDRETQKYKRQAQADRVNLRKLRGYYNQSEDGSHTLQRMFGCDLGP
FT                   DGRLLRGYNQFAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQRRAYLEGTC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*04 variant"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..646
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*04 variant"
FT                   /number=3
XX
SQ   Sequence 646 BP; 108 A; 166 C; 200 G; 72 T; 100 other;
     gctcccactc catgaggtat ttctccacat ccgtgtcctg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagcccaag aggggagccg cgggagccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaagtac aagcgccagg cacaggctga ccgagtgaac ctgcggaaac       240
     tgcgcggcta ctacaaccag agcgaggacg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ggtctcacac cctccagagg atgtttggct gcgacctggg gccggacggg       420
     cgcctcctcc gcgggtataa ccagttcgcc tacgacggca aggattacat cgccctgaac       480
     gaggatctgc gctcctggac cgccgcggac acggcggctc agatcaccca gcgcaagtgg       540
     gaggcggccc gtgaggcgga gcagcggaga gcctacctgg agggcacgtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gcgcgg                      646
//