Dbfetch

ID   FJ648689; SV 1; linear; genomic DNA; STD; HUM; 2813 BP.
XX
AC   FJ648689;
XX
DT   03-MAR-2009 (Rel. 100, Created)
DT   03-MAR-2009 (Rel. 100, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*54 variant allele,
DE   complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2813
RA   Hogan H.M., Sayer D.C., Koay E.S., Huan P.T.;
RT   ;
RL   Submitted (21-JAN-2009) to the INSDC.
RL   Conexio Genomics, Pakenham Street, Fremantle, W.A. 6160, Australia
XX
DR   MD5; ecf8408d4379ee7e2467c784e51ea2bb.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2813
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            1..2813
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*54 variant"
FT   mRNA            join(1..96,225..494,740..1015,1591..1866,1971..2087,
FT                   2529..2561,2668..2813)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*54 variant"
FT                   /product="MHC class I antigen"
FT   exon            1..96
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*54 variant"
FT                   /number=1
FT   5'UTR           1..23
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*54 variant"
FT   CDS             join(24..96,225..494,740..1015,1591..1866,1971..2087,
FT                   2529..2561,2668..2711)
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*54 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:C0KZ90"
FT                   /db_xref="IMGT/HLA:B*54:18"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:C0KZ90"
FT                   /protein_id="ACN38394.1"
FT                   /translation="MRVTAPRTLLLLLWGALALTETWAGSHSMKYFYTAMSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRNTQIYKAQAQTDRESLRN
FT                   LRGYYNQSEAGSHTWQTMYGCDLGPDGRLLRGHNQLAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAARVAEQLRAYLEGTCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTIPIVGIVAGLAVLAVVVIGAVVATVMCRRKSSGGK
FT                   GGSYSQAASSDSAQGSDVSLTA"
FT   exon            225..494
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*54 variant"
FT                   /number=2
FT   exon            740..1015
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*54 variant"
FT                   /number=3
FT   exon            1591..1866
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*54 variant"
FT                   /number=4
FT   exon            1971..2087
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*54 variant"
FT                   /number=5
FT   exon            2529..2561
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*54 variant"
FT                   /number=6
FT   exon            2668..2813
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*54 variant"
FT                   /number=7
FT   3'UTR           2712..2813
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*54 variant"
XX
SQ   Sequence 2813 BP; 521 A; 811 C; 918 G; 563 T; 0 other;
     tcagagtctc ctcagacacc gagatgcggg tcacggcacc ccgaaccctc ctcctgctgc        60
     tctggggggc cctggccctg accgagacct gggccggtga gtgcgggtcg ggagggaaat       120
     ggcctctgtg gggaggagcg aggggaccgc aggcgggggc gcaggacccg gggagccgcg       180
     ccgggaggag ggtctggcgg gtctcagccc ctcctcgccc ccaggctccc actccatgaa       240
     gtatttctac accgccatgt cccggcccgg ccgcggggag ccccgcttca tcgcagtggg       300
     ctacgtggac gacacgcagt tcgtgcggtt cgacagcgac gccgcgagtc cgagagggga       360
     gccgcgggcg ccgtgggtgg agcaggaggg gccggagtat tgggaccgga acacacagat       420
     ctacaaggcc caggcacaga ctgaccgaga gagcctgcgg aacctgcgcg gctactacaa       480
     ccagagcgag gccggtgagt gaccccggcc cggggcgcag gtcacgactc cccatccccc       540
     acgtacggcc cgggtcgccc cgagtctccg ggtccgagat ccgcctccct gaggccgcgg       600
     gacccgccca gaccctcgac cggcgagagc cccaggcgcg tttacccggt ttcattttca       660
     gttgaggcca aaatccccgc gggttggtcg gggcggggcg gggctcgggg gacggggctg       720
     accgcggggc cggggccagg gtctcacact tggcagacga tgtatggctg cgacctgggg       780
     ccggacgggc gcctcctccg cgggcataac cagttagcct acgacggcaa ggattacatc       840
     gccctgaacg aggacctgag ctcctggacc gcggcggaca ccgcggctca gatcacccag       900
     cgcaagtggg aggcggcccg tgtggcggag cagctgagag cctacctgga gggcacgtgc       960
     gtggagtggc tccgcagata cctggagaac gggaaggaga cgctgcagcg cgcgggtacc      1020
     aggggcagtg gggagccttc cccatctcct ataggtcgcc ggggatggcc tcccacgaga      1080
     agaggaggaa aatgggatca gcgctagaat gtcgccctcc cttgaatgga gaatggcatg      1140
     agttttcctg agtttcctct gagggccccc tcttctctct aggacaatta agggatgacg      1200
     tctctgagga aatggagggg aagacagtcc ctagaatact gatcaggggt cctctttgac      1260
     ccctgcagca gccttgggaa ccgtgacttt tcctctcagg ccttgttctc tgcctcacac      1320
     tcagtgtgtt tggggctctg attccagcac ttctgagtca ctttacctcc actcagatca      1380
     ggagcagaag tccctgttcc ccgctcagag actcgaactt tccaatgaat aggagattat      1440
     cccaggtgcc tgcgtccagg ctggtgtctg ggttctgtgc cccttcccca ccccaggtgt      1500
     cctgtccatt ctcaggctgg tcacatgggt ggtcctaggg tgtcctatga gagatgcaaa      1560
     gcgcctgaat tttctgactc ttcccatcag accccccaaa gacacacgtg acccaccacc      1620
     ccatctctga ccatgaggcc accctgaggt gctgggccct gggcttctac cctgcggaga      1680
     tcacactgac ctggcagcgg gatggcgagg accaaactca ggacactgag cttgtggaga      1740
     ccagaccagc aggagataga accttccaga agtgggcagc tgtggtggtg ccttctggag      1800
     aagagcagag atacacatgc catgtacagc atgaggggct gccgaagccc ctcaccctga      1860
     gatggggtaa ggagggggat gaggggtcat atctcttctc agggaaagca ggagcccttc      1920
     tggagccctt cagcagggtc agggcccctc gtcttcccct cctttcccag agccatcttc      1980
     ccagtccacc atccccatcg tgggcattgt tgctggcctg gctgtcctag cagttgtggt      2040
     catcggagct gtggtcgcta ctgtgatgtg taggaggaag agctcaggta gggaaggggt      2100
     gaggggtggg gtctgggttt tcttgtccca ctgggggttt caagccccag gtagaagtgt      2160
     tccctgcctc attactggga agcagcatcc acacaggggc taatgcagcc tgggaccctg      2220
     tgtgccagca cttactcttt tgtgcagcac atgtgacaat gaaggacgga tgtatcacct      2280
     tgatggttgt ggtgttgggg tcctgatttc agcattcatg agtcagggga aggtccctgc      2340
     taaggacaga ccttaggagg gcagttggtc caggacccac acttgctttc ctcgtgtttc      2400
     ctgatcctgc cttgggtctg tagtcatact tctggaaatt ccttttgggt ccaagacgag      2460
     gaggttcctc taagatctca tggccctgct tcctcccagt cccctcacag gacattttct      2520
     tcccacaggt ggaaaaggag ggagctactc tcaggctgcg tgtaagtggt gggggtggga      2580
     gtgtggagga gctcacccac cccataattc ctcctgtccc acgtctcctg cgggctctga      2640
     ccaggtcctg tttttgttct actccagcca gcgacagtgc ccagggctct gatgtgtctc      2700
     tcacagcttg aaaaggtgag attcttgggg tctagagtgg gcgggggggg gtggggtggg      2760
     gagggggcag aggggaaagg cctgggtaat ggagattctt tgattgggat gtt             2813
//