spacer

EBI Dbfetch

ID   FJ648688; SV 1; linear; genomic DNA; STD; HUM; 2647 BP.
XX
AC   FJ648688;
XX
DT   03-MAR-2009 (Rel. 100, Created)
DT   03-MAR-2009 (Rel. 100, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*39 variant allele,
DE   exons 1 through 6 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2647
RA   Hogan H.M., Sayer D.C., Koay E.S., Huan P.T.;
RT   ;
RL   Submitted (21-JAN-2009) to the INSDC.
RL   Conexio Genomics, Pakenham Street, Fremantle, W.A. 6160, Australia
XX
DR   MD5; a7b0c00ea3fabeb35aa0b5fcea53aa70.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2647
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            1..>2647
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*39 variant"
FT   mRNA            join(1..96,225..494,741..1016,1589..1864,1958..2074,
FT                   2516..>2548)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*39 variant"
FT                   /product="MHC class I antigen"
FT   exon            1..96
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*39 variant"
FT                   /number=1
FT   5'UTR           1..23
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*39 variant"
FT   CDS             join(24..96,225..494,741..1016,1589..1864,1958..2074,
FT                   2516..>2548)
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*39 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:C0KZ89"
FT                   /db_xref="IMGT/HLA:B*39:49"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:C0KZ89"
FT                   /protein_id="ACN38393.1"
FT                   /translation="MLVMAPRTVLLLLSAALALTETWAGSHSMRYFYTSVSRPGRGEPR
FT                   FISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRETQISKTNTQTYRESLRN
FT                   LRGYYNQSEAGSHTLQRMYGCDVGPDGRLLRGHDQFAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAARVAEQLRTYLEGTCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSSGGK
FT                   GGSYSQAA"
FT   exon            225..494
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*39 variant"
FT                   /number=2
FT   exon            741..1016
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*39 variant"
FT                   /number=3
FT   exon            1589..1864
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*39 variant"
FT                   /number=4
FT   exon            1958..2074
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*39 variant"
FT                   /number=5
FT   exon            2516..2548
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*39 variant"
FT                   /number=6
XX
SQ   Sequence 2647 BP; 494 A; 786 C; 841 G; 526 T; 0 other;
     tcagagtctc ctcagacgcc gagatgctgg tcatggcgcc ccgaaccgtc ctcctgctgc        60
     tctcggcggc cctggccctg accgagacct gggccggtga gtgcgggtcg ggagggaaat       120
     ggcctctgcc gggaggagcg aggggaccgc aggcgggggc gcaggacctg aggagccgcg       180
     ccgggaggag ggtcgggcgg gtctcagccc ctcctcgccc ccaggctccc actccatgag       240
     gtatttctac acctccgtgt cccggcccgg ccgcggggag ccccgcttca tctcagtggg       300
     ctacgtggac gacacgcagt tcgtgaggtt cgacagcgac gccgcgagtc cgagagagga       360
     gccgcgggcg ccgtggatag agcaggaggg gccggagtat tgggaccggg agacacagat       420
     ctccaagacc aacacacaga cttaccgaga gagcctgcgg aacctgcgcg gctactacaa       480
     ccagagcgag gccggtgagt gaccccggcc cggggcgcag gtcacgactc cccatccccc       540
     acgtacggcc cgggtcgccc cgagtctccg ggtccgagat ccgcctccct gaggccgcgg       600
     gacccgccca gaccctcgac cggcgagagc cccaggcgcg tttacccggt ttcattttca       660
     gttgaggcca aaatccccgc gggttggtcg gggcggggcg gggctcgggg ggacggggct       720
     gaccgcgggg ccggggccag ggtctcacac cctccagagg atgtacggct gcgacgtggg       780
     gccggacggg cgcctcctcc gcgggcatga ccagttcgcc tacgacggca aggattacat       840
     cgccctgaac gaggacctga gctcctggac cgcggcggac accgcggctc agatcaccca       900
     gcgcaagtgg gaggcggccc gtgtggcgga gcagctgaga acctacctgg agggcacgtg       960
     cgtggagtgg ctccgcagat acctggagaa cgggaaggag acgctgcagc gcgcgggtac      1020
     caggggcagt ggggagcctt ccccatctcc tataggtcgc cggggatggc ctccaacgag      1080
     aagaagagga aaatgggatc agcgctagaa tgtcgccctc ccttgaatgg agaatggcat      1140
     gagttttcct gagtttcctc tgagggcccc ctcttctctc taggacaatt aagggatgac      1200
     gtctctgagg aaatggaggg gaagacagtc cctagaatac tgatcagggg tcccctttga      1260
     cccctgcagc agccttggga accatgactt ttcctctcag gccttgttct ctgcctcaca      1320
     ctcagtgtgt ttggggctct gattccagca cttctgagtc actttacctc cactcagatc      1380
     aggagcagaa gtctctgttc cccgctcaga gactcgaact ttccaatgaa tagattatcc      1440
     caggtgcctg cgtccaggct ggtgtctggg ttctgtgccc cttccccacc ccaggtgtcc      1500
     tgtccattct caggctggtc acatgggtgg tcctagggtg tcccatgaga gatgcaaagc      1560
     gcctgaattt tctgactctt cccatcagac cccccaaaga cacatgtgac ccaccacccc      1620
     atctctgacc atgaggccac cctgaggtgc tgggccctgg gcttctaccc tgcggagatc      1680
     acactgacct ggcagcggga tggcgaggac caaactcagg acaccgagct tgtggagacc      1740
     agaccagcag gagacagaac cttccagaag tgggcagctg tggtggtgcc ttctggagaa      1800
     gagcagagat acacatgcca tgtacagcat gaggggctgc cgaagcccct caccctgaga      1860
     tggggtaagg agggggatga ggggtcatat ctcttctcag ggaaagcagg agcccttcag      1920
     cagggtcagg gcccctcatc ttcccctcct ttcccagagc catcttccca gtccaccgtc      1980
     cccatcgtgg gcattgttgc tggcctggct gtcctagcag ttgtggtcat cggagctgtg      2040
     gtcgctgctg tgatgtgtag gaggaagagt tcaggtaggg aaggggtgag gggtggggtc      2100
     tgggttttct tgtcccactg ggggtttcaa gccccaggta gaagtgttcc ctgcatcatt      2160
     actgggaagc agcatgcaca caggggctaa cgcagcctgg gaccctgtgt gccagcactt      2220
     actcttttgt gcagcacatg tgacaatgaa ggacggatgt atcaccttga tggttgtggt      2280
     gttggggtcc tgattccagc attcatgagt caggggaagg tccctgctaa ggacagacct      2340
     taggagggca gttggtccag gacccacact tgctttcctc gtgtttcctg atcctgccct      2400
     gggtctgtag tcatacttct ggaaattcct tttgggtcca agactaggag gttcctctaa      2460
     gatctcatgg ccctgcttcc tcccagtccc ctcacaggac attttcttcc cacaggtgga      2520
     aaaggaggga gctactctca ggctgcgtgt aagtggtggg ggtgggagtg tggaggagct      2580
     cacccacccc ataattcctc ctgtcccacg tctcctgtgg gctctgacca ggtcctgttt      2640
     ttgttct                                                                2647
//


spacer
spacer