Dbfetch

ID   FJ648687; SV 1; linear; genomic DNA; STD; HUM; 1995 BP.
XX
AC   FJ648687;
XX
DT   03-MAR-2009 (Rel. 100, Created)
DT   03-MAR-2009 (Rel. 100, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*40 variant allele,
DE   exons 1 through 5 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1995
RA   Hogan H.M., Sayer D.C., Koay E.S., Huan P.T.;
RT   ;
RL   Submitted (20-JAN-2009) to the INSDC.
RL   Conexio Genomics, Pakenham Street, Fremantle, W.A. 6160, Australia
XX
DR   MD5; c00e9bf60d5ff451a7514dddb5f73473.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1995
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            1..>1995
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40 variant"
FT   mRNA            join(1..93,223..492,737..1012,1588..1863,1957..>1995)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40 variant"
FT                   /product="MHC class I antigen"
FT   exon            1..93
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40 variant"
FT                   /number=1
FT   5'UTR           1..20
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40 variant"
FT   CDS             join(21..93,223..492,737..1012,1588..1863,1957..>1995)
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="IMGT/HLA:B*40:97"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:C0KZ88"
FT                   /protein_id="ACN38392.1"
FT                   /translation="MRVTAPRTLLLLLWGAVALTETWAGSHSMRYFHTSVSRPGRGEPR
FT                   FITVGYVDDTLFVRFDSDATSPRKEPRAPWIEQEGPEYWDRETQISKTNTQTYRESLRN
FT                   LRGYYNQSEAGSHTLQSMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKWEAARVAEQLRAYLEGECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTEFVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTVPIVGI"
FT   exon            223..492
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40 variant"
FT                   /number=2
FT   exon            737..1012
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40 variant"
FT                   /number=3
FT   exon            1588..1863
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40 variant"
FT                   /number=4
FT   exon            1957..>1995
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40 variant"
FT                   /number=5
XX
SQ   Sequence 1995 BP; 376 A; 624 C; 650 G; 345 T; 0 other;
     gaatctcctc agacgccgag atgcgggtca cggcgccccg aaccctcctc ctgctgctct        60
     ggggggcagt ggccctgacc gagacctggg ctggtgagtg cggggtcggc agggaaatgg       120
     cctctgtggg gaggagcgag gggaccgcag gcgggggcgc aggacccggg gagccgcgcc       180
     gggaggaggg tcgggcgggt ctcagcccct cctcgccccc aggctcccac tccatgaggt       240
     atttccacac ctccgtgtcc cggcccggcc gcggggagcc ccgcttcatc accgtgggct       300
     acgtggacga cacgctgttc gtgaggttcg acagcgacgc cacgagtccg aggaaggagc       360
     cgcgggcgcc atggatagag caggaggggc cggagtattg ggaccgggag acacagatct       420
     ccaagaccaa cacacagact taccgagaga gcctgcggaa cctgcgcggc tactacaacc       480
     agagcgaggc cggtgagtga ccccggcccg gggcgcaggt cacgactccc catcccccac       540
     gtacggcccg ggtcgccccg agtctccggg tccgagatcc gcccccgagg ccgcgggacc       600
     cgcccagacc ctcgaccggc gagagcccca ggcgcgttta cccggtttca ttttcagttg       660
     aggccaaaat ccccgcgggt tggtcggggc ggggcggggc tcggggggac ggggctgacc       720
     gcgggggcgg ggccagggtc tcacaccctc cagagcatgt acggctgcga cgtggggccg       780
     gacgggcgcc tcctccgcgg gcataaccag tacgcctacg acggcaagga ttacatcgcc       840
     ctgaacgagg acctgcgctc ctggaccgcc gcggacacgg cggctcagat cacccagcgc       900
     aagtgggagg cggcccgtgt ggcggagcag ctgagagcct acctggaggg cgagtgcgtg       960
     gagtggctcc gcagatacct ggagaacggg aaggagacgc tgcagcgcgc gggtaccagg      1020
     ggcagtgggg agccttcccc atctcctata ggtcgccggg gatggcctcc cacgagaaga      1080
     ggaggaaaat gggatcagcg ctagaatgtc gccctccctt gaatggagaa tggcatgagt      1140
     tttcctgagt ttcctctgag ggccccctct tctctctagg acaattaagg gatgacgtct      1200
     ctgaggaaat ggaggggaag acagtcccta gaatactgat caggggtccc ctttgacccc      1260
     tgcagcagcc ttgggaaccg tgacttttcc tctcaggcct tgttctctgc ctcacactca      1320
     gtgtgtttgg ggctctgatt ccagcacttc tgagtcactt tacctccact cagatcagga      1380
     gcagaagtcc ctgttccccg ctcagagact cgaactttcc aatgaatagg agattatccc      1440
     aggtgcctgc gtccaggctg gtgtctgggt tctgtgcccc ttccccaccc caggtgtcct      1500
     gtccattctc aggctggtca catgggtggt cctagggtgt cccatgagag atgcaaagcg      1560
     cctgaatttt ctgactcttc ccatcagacc ccccaaagac acacgtgacc caccacccca      1620
     tctctgacca tgaggccacc ctgaggtgct gggccctggg cttctaccct gcggagatca      1680
     cactgacctg gcagcgggat ggcgaggacc aaactcagga cactgagttt gtggagacca      1740
     gaccagcagg agatagaacc ttccagaagt gggcagctgt ggtggtgcct tctggagaag      1800
     agcagagata cacatgccat gtacagcatg aggggctgcc gaagcccctc accctgagat      1860
     ggggtaagga gggggatgag gggtcatatc tcttctcagg gaaagcagga gcccttcagc      1920
     agggtcaggg cccctcatct tcccttcctt tcccagagcc gtcttcccag tccaccgtcc      1980
     ccatcgtggg cattg                                                       1995
//