spacer

EBI Dbfetch

ID   FJ644941; SV 1; linear; genomic DNA; STD; HUM; 2687 BP.
XX
AC   FJ644941;
XX
DT   24-FEB-2009 (Rel. 99, Created)
DT   25-SEP-2009 (Rel. 102, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*37new allele, complete
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2687
RX   DOI; 10.1111/j.1399-0039.2009.01323.x.
RX   PUBMED; 19775373.
RA   Jin S.-Z., Li Z., Zou H.-Y., Cheng X., Cheng L.-H., Wang D.-M.;
RT   "A novel HLA-B*37 allele, B*370105, was identified in a Chinese Han
RT   individual";
RL   Tissue Antigens 74(4):344-345(2009).
XX
RN   [2]
RP   1-2687
RA   Jin S.-Z., Cheng X., Zou H.-Y., Cheng L.-H., Zhu W.-G.;
RT   "A new HLA-B*37 allele observed in Chinese Han";
RL   Unpublished.
XX
RN   [3]
RP   1-2687
RA   Jin S.-Z., Cheng X., Zou H.-Y., Cheng L.-H., Zhu W.-G.;
RT   ;
RL   Submitted (18-JAN-2009) to the INSDC.
RL   Shenzhen Blood Center, Nigang West Road, Shenzhen, Guangdong 518035, China
XX
DR   MD5; c4312bfb5ca6f84d1c4b2c444107b844.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2687
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>2687
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*37new"
FT   mRNA            join(<1..73,203..472,719..994,1567..1842,1947..2063,
FT                   2505..2537,2644..>2687)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*37new"
FT                   /product="MHC class I antigen"
FT   CDS             join(1..73,203..472,719..994,1567..1842,1947..2063,
FT                   2505..2537,2644..2687)
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*37new"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:C0KXH2"
FT                   /db_xref="IMGT/HLA:B*37:01:05"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:C0KXH2"
FT                   /protein_id="ACN22290.1"
FT                   /translation="MRVTAPRTLLLLLWGAVALTETWAGSHSMRYFHTSVSRPGRGEPR
FT                   FISVGYVDDTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDRETQISKTNTQTYREDLRT
FT                   LLRYYNQSEAGSHTIQRMSGCDVGPDGRLLRGYNQFAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAARVAEQDRAYLEGTCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTIPIVGIVAGLAVLAVVVIGAVVATVMCRRKSSGGK
FT                   GGSYSQAASSDSAQGSDVSLTA"
FT   exon            <1..73
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*37new"
FT                   /number=1
FT   exon            203..472
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*37new"
FT                   /number=2
FT   exon            719..994
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*37new"
FT                   /number=3
FT   variation       933
FT                   /gene="HLA-B"
FT                   /replace="c"
FT   exon            1567..1842
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*37new"
FT                   /number=4
FT   exon            1947..2063
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*37new"
FT                   /number=5
FT   exon            2505..2537
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*37new"
FT                   /number=6
FT   exon            2644..>2687
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*37new"
FT                   /number=7
XX
SQ   Sequence 2687 BP; 500 A; 803 C; 849 G; 535 T; 0 other;
     atgcgggtca cggcgccccg aaccctcctc ctgctgctct ggggggcagt ggccctgacc        60
     gagacctggg ctggtgagtg cggggtcggc agggaaatgg cctctgtggg gaggagcgag       120
     gggaccgcag gcgggggcgc aggacccggg gagccgcgcc gggaggaggg tcgggcgggt       180
     ctcagcccct cctcgccccc aggctcccac tccatgaggt atttccacac ctccgtgtcc       240
     cggcccggcc gcggggagcc ccgcttcatc tcagtgggct acgtggacga cacccagttc       300
     gtgaggttcg acagcgacgc cgcgagtccg aggacggagc cccgggcgcc gtggatagag       360
     caggaggggc cggagtattg ggaccgggag acacagatct ccaagaccaa cacacagact       420
     taccgagagg acctgcggac cctgctccgc tactacaacc agagcgaggc cggtgagtga       480
     ccccggcccg gggcgcaggt cacgactccc catcccccac gtacggcccg ggtcgccccg       540
     agtctccggg tccgagatcc gcccccctga ggccgcggga cccgcccaga ccctcgaccg       600
     gcgagagccc caggcgcgtt tacccggttt cattttcagt tgaggccaaa atccccgcgg       660
     gttggtcggg gcggggcggg gctcgggggg acggggctga ccgcggggcc ggggccaggg       720
     tctcacacca tccagaggat gtctggctgc gacgtggggc cggacgggcg cctcctccgc       780
     gggtataacc agttcgccta cgacggcaag gattacatcg ccctgaacga ggacctgagc       840
     tcctggaccg cggcggacac cgcggctcag atcacccagc gcaagtggga ggcggcccgt       900
     gtggcggagc aggacagagc ctacctggag ggaacgtgcg tggagtggct ccgcagatac       960
     ctggagaacg ggaaggagac gctgcagcgc gcgggtacca ggggcagtgg ggagccttcc      1020
     ccatctccta taggtcgccg gggatggcct cccacgagaa gaggaggaaa atgggatcag      1080
     cgctagaatg tcgccctccc ttgaatggag aatggcatga gttttcctga gtttcctctg      1140
     agggccccct cttctctcta ggacaattaa gggatgacgt ctctgaggaa atggagggga      1200
     agacagtccc tagaatactg atcaggggtc ccctttgacc cctgcagcag ccttgggaac      1260
     catgactttt cctctcaggc cttgttctct gcctcacact cagtgtgttt ggggctctga      1320
     ttccagcact tctgagtcac tttacctcca ctcagatcag gagcagaagt ctctgttccc      1380
     cgctcagaga ctcgaacttt ccaatgaata gattatccca ggtgcctgcg tccaggctgg      1440
     tgtctgggtt ctgtgcccct tccccacccc aggtgtcctg tccattctca ggctggtcac      1500
     atgggtggtc ctagggtgtc ccatgagaga tgcaaagcgc ctgaattttc tgactcttcc      1560
     catcagaccc cccaaagaca catgtgaccc accaccccat ctctgaccat gaggccaccc      1620
     tgaggtgctg ggccctgggc ttctaccctg cggagatcac actgacctgg cagcgggatg      1680
     gcgaggacca aactcaggac accgagcttg tggagaccag accagcagga gatagaacct      1740
     tccagaagtg ggcagctgtg gtggtgcctt ctggagaaga gcagagatac acatgccatg      1800
     tacagcatga ggggctgccg aagcccctca ccctgagatg gggtaaggag ggggatgagg      1860
     ggtcatatct cttctcaggg aaagcaggag cccttctgga gcccttcagc agggtcagga      1920
     cccctcatct tcccctcctt tcccagagcc atcttcccag tccaccatcc ccatcgtggg      1980
     cattgttgct ggcctggctg tcctagcagt tgtggtcatc ggagctgtgg tcgctactgt      2040
     gatgtgtagg aggaagagct caggtaggga aggggtgagg ggtggggtct gggttttctt      2100
     gtcccactgg gggtttcaag ccccaggtag aagtgttccc tgcctcatta ctgggaagca      2160
     gcatccacac aggggctaac gcagcctggg accctgtgtg ccagcactta ctcttttgtg      2220
     cagcacatgt gacaatgaag gacggatgta tcaccttgat ggttgtggtg ttggggtcct      2280
     gattccagca ttcatgagtc aggggaaggt ccctgctaag gacagacctt aggagggcag      2340
     ttggtccagg acccacactt gctttcctcg tgtttcctga tcctgccttg ggtctgtagt      2400
     catacttctg gaaattcctt ttggttccaa gacgaggagg ttcctctaag atctcatggc      2460
     cctgcttcct cccagtcccc tcacaggaca ttttcttccc acaggtggaa aaggagggag      2520
     ctactctcag gctgcgtgta agtggtgggg gtgggagtgt ggaggagctc acccacccca      2580
     taattcctcc tgtcccacgt ctcctgcggg ctctgaccag gtcctgtttt tgttctactc      2640
     cagccagcga cagtgcccag ggctctgatg tgtctctcac agcttga                    2687
//


spacer
spacer