spacer

EBI Dbfetch

ID   FJ619520; SV 1; linear; genomic DNA; STD; HUM; 2007 BP.
XX
AC   FJ619520;
XX
DT   17-FEB-2009 (Rel. 99, Created)
DT   17-FEB-2009 (Rel. 99, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*2495 allele, exons 1
DE   through 5 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2007
RA   Callender C., Eller S.R., Iglehart B.S., Leffell M.S.;
RT   "Identification of a Novel Allele: HLA-A*24New";
RL   Unpublished.
XX
RN   [2]
RP   1-2007
RA   Callender C., Eller S.R., Iglehart B.S., Leffell M.S.;
RT   ;
RL   Submitted (12-JAN-2009) to the INSDC.
RL   Medicine, Johns Hopkins University, 2041 E. Monument St., Baltimore, MD
RL   21205, USA
XX
DR   MD5; 7ecfadcdcff15c7b08c56de80b9c83cf.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2007
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>2007
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2495"
FT   mRNA            join(<1..61,192..461,703..978,1558..1833,1936..>2007)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2495"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..61,192..461,703..978,1558..1833,1936..>2007)
FT                   /codon_start=1
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2495"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:C0KLT0"
FT                   /db_xref="IMGT/HLA:A*24:95"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:C0KLT0"
FT                   /protein_id="ACM90165.1"
FT                   /translation="APRTLVLLLSGALALTQTWAGSHSMGYFSTSVSRPGRGEPRFIAV
FT                   GYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRIALRY
FT                   YNQSEAGSHTLQMMFGCDVGSDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQIT
FT                   KRKWEAAHVAEQQRAYLEGTCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLR
FT                   CWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHV
FT                   QHEGLPKPLTLRWEPSSQPTVPIVGIIAGLVLLGAVI"
FT   exon            <1..61
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2495"
FT                   /number=1
FT   exon            192..461
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2495"
FT                   /number=2
FT   exon            703..978
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2495"
FT                   /number=3
FT   exon            1558..1833
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2495"
FT                   /number=4
FT   exon            1936..>2007
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2495"
FT                   /number=5
XX
SQ   Sequence 2007 BP; 376 A; 626 C; 646 G; 359 T; 0 other;
     gcgccccgaa ccctcgtcct gctactctcg ggggccctgg ccctgaccca gacctgggca        60
     ggtgagtgcg gggtcgggag ggaaacggcc tctgcgggga gaagcaaggg gcccgcctgg       120
     cgggggcgca agacccggga agccgcgccg ggaggagggt cgggcgggtc tcagccactc       180
     ctcgtcccca ggctcccact ccatggggta tttctccaca tccgtgtccc ggcccggccg       240
     cggggagccc cgcttcatcg ccgtgggcta cgtggacgac acgcagttcg tgcggttcga       300
     cagcgacgcc gcgagccaga ggatggagcc gcgggcgccg tggatagagc aggaggggcc       360
     ggagtattgg gacgaggaga cagggaaagt gaaggcccac tcacagactg accgagagaa       420
     cctgcggatc gcgctccgct actacaacca gagcgaggcc ggtgagtgac cccggcccgg       480
     ggcgcaggtc acgacccctc atcccccacg gacgggccgg gtcgcccaca gtctccgggt       540
     ccgagatcca ccccgaagcc gcgggacccc gagacccttg ccccgggaga ggcccaggcg       600
     ccttaacccg gtttcatttt cagtttaggc caaaaatccc cccgggttgg tcggggccgg       660
     gcggggctcg ggggactggg ctgaccgcgg ggtcggggcc aggttctcac accctccaga       720
     tgatgtttgg ctgcgacgtg gggtcggacg ggcgcttcct ccgcgggtac caccagtacg       780
     cctacgacgg caaggattac atcgccctga aagaggacct gcgctcttgg accgcggcgg       840
     acatggcggc tcagatcacc aagcgcaagt gggaggcggc ccatgtggcg gagcagcaga       900
     gagcctacct ggagggcacg tgcgtggacg ggctccgcag atacctggag aacgggaagg       960
     agacgctgca gcgcacgggt accaggggcc acggggcgcc tacctgatcg cctgtaggtc      1020
     tcccgggctg gcctcccaca aggaggggag acaattggga ccaacactag aatatcgccc      1080
     tccctctggt cctgagggag aggaatcctc ctgggtttcc agatcctgta ccagagagtg      1140
     actctgaggt tccgccctgc tctctgacac aattaaggga taaaatctct gacggaatga      1200
     cggaaagacg atccctcgaa tactgatgac tggttccctt tgacaccggc agcagccttg      1260
     ggaccgtgac ttttcctctc aggccttgtt ctctgcttca cactcaatgt gtgtgggggt      1320
     ctgagtccag cacttctgag tccctcagcc tccactcagg tcaggaccag aagtcgctgt      1380
     tccctcctca gggaatagaa gattatccca ggtgcctgtg tccaggctgg tgtctgggtt      1440
     ctgtgctctc ttccccatcc cgggtgtcct gtccattctc aagatggcca catgcatgct      1500
     ggtggagtgt cccatgacag atgcaaaatg cctgaatttt ctgactcttc ccgtcagacc      1560
     cccccaagac acatatgacc caccacccca tctctgacca tgaggccact ctgagatgct      1620
     gggccctggg cttctaccct gcggagatca cactgacctg gcagcgggat ggggaggacc      1680
     agacccagga cacggagctt gtggagacca ggcctgcagg ggatggaacc ttccagaagt      1740
     gggcagctgt ggtggtacct tctggagagg agcagagata cacctgccat gtgcagcatg      1800
     agggtctgcc caagcccctc accctgagat ggggtaagga gggagatggg ggtgtcatgt      1860
     ctcttaggga aagcaggagc ctctctggag acctttagca gggtcagggc ccctcacctt      1920
     cccctctttt cccagagcca tcttcccagc ccaccgtccc catcgtgggc atcattgctg      1980
     gcctggttct ccttggagct gtgatca                                          2007
//


spacer
spacer