spacer

EBI Dbfetch

ID   FJ609980; SV 1; linear; genomic DNA; STD; HUM; 276 BP.
XX
AC   FJ609980;
XX
DT   11-FEB-2009 (Rel. 99, Created)
DT   11-FEB-2009 (Rel. 99, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*1530 allele, exon 4
DE   and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-276
RA   Alaez C., Munguia A., Flores H., Gorodezky C.;
RT   ;
RL   Submitted (07-JAN-2009) to the INSDC.
RL   Department of Immunology and Immunogenetics, Instituto de Diagnostico y
RL   Referencia Epidemiologicas, Carpio 470 1st Floor, DF 11340, Mexico
XX
DR   MD5; 32d7c44dafe7b3bbb0bdb49708683b3d.
DR   Ensembl-Gn; ENSG00000206450; homo_sapiens.
DR   Ensembl-Gn; ENSG00000223532; homo_sapiens.
DR   Ensembl-Gn; ENSG00000232126; homo_sapiens.
DR   Ensembl-Gn; ENSG00000234745; homo_sapiens.
DR   Ensembl-Tr; ENST00000359635; homo_sapiens.
DR   Ensembl-Tr; ENST00000412585; homo_sapiens.
DR   Ensembl-Tr; ENST00000416726; homo_sapiens.
DR   Ensembl-Tr; ENST00000418147; homo_sapiens.
DR   Ensembl-Tr; ENST00000425798; homo_sapiens.
DR   Ensembl-Tr; ENST00000425848; homo_sapiens.
DR   Ensembl-Tr; ENST00000450871; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..276
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>276
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1530"
FT   mRNA            <1..>276
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1530"
FT                   /product="MHC class I antigen"
FT   CDS             <1..>276
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1530"
FT                   /product="MHC class I antigen"
FT                   /db_xref="IMGT/HLA:B*15:30"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:B9VWB1"
FT                   /protein_id="ACM68929.1"
FT                   /translation="PPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDT
FT                   ELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW"
FT   exon            1..276
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1530"
FT                   /number=4
XX
SQ   Sequence 276 BP; 68 A; 84 C; 82 G; 42 T; 0 other;
     accccccaaa gacacatgtg acccaccacc ccatctctga ccatgaggcc accctgaggt        60
     gctgggccct gggcttctac cctgcggaga tcacactgac ctggcagcgg gatggcgagg       120
     accaaactca ggacaccgag cttgtggaga ccagaccagc aggagataga accttccaga       180
     agtgggcagc tgtggtggtg ccttctggag aagagcagag atacacatgc catgtacagc       240
     atgaggggct gccgaagccc ctcaccctga gatggg                                 276
//


spacer
spacer