spacer

EBI Dbfetch

ID   FJ594768; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   FJ594768;
XX
DT   08-FEB-2009 (Rel. 99, Created)
DT   08-FEB-2009 (Rel. 99, Last updated, Version 1)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*14 variant
DE   allele, exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Lee T.-D., Chien W.-C.;
RT   "A new DR14-related DRB1 allele, identified by sequence-based typing";
RL   Unpublished.
XX
RN   [2]
RP   1-270
RA   Lee T.-D., Chien W.-C.;
RT   ;
RL   Submitted (25-DEC-2008) to the INSDC.
RL   Research and Development, Healthbanks Biotech Co., Ltd., Building B, Room
RL   405, 18 Sihyuan St., Jungieng, Taipei 10091, Taiwan, R.O.C.
XX
DR   MD5; 8c2e971ee9299561bbe64fd45c809cc5.
DR   Ensembl-Gn; ENSG00000196126; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206240; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206306; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228080; homo_sapiens.
DR   Ensembl-Tr; ENST00000328980; homo_sapiens.
DR   Ensembl-Tr; ENST00000360004; homo_sapiens.
DR   Ensembl-Tr; ENST00000399450; homo_sapiens.
DR   Ensembl-Tr; ENST00000412634; homo_sapiens.
DR   Ensembl-Tr; ENST00000415796; homo_sapiens.
DR   Ensembl-Tr; ENST00000419393; homo_sapiens.
DR   Ensembl-Tr; ENST00000428566; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /country="Taiwan"
FT                   /tissue_type="peripheral blood; cord blood"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*14 variant"
FT                   /note="paternal allele"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*14 variant"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*14 variant"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q9GIY3"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*14:84"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9GIY3"
FT                   /protein_id="ACM47962.1"
FT                   /translation="RFLEYSTSECQFFNGTERVRFLDRYFHNQEEFVRFDSDVGEYRAV
FT                   TELGRPDAEYWNSQKDLLEDRRALVDTYCRHNYGVVESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*14 variant"
FT                   /number=2
XX
SQ   Sequence 270 BP; 57 A; 66 C; 96 G; 51 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcaattctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc cataaccagg aggagttcgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacctcct ggaagacagg cgggccctgg tggacaccta ctgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer