spacer

EBI Dbfetch

ID   FJ594417; SV 1; linear; genomic DNA; STD; HUM; 645 BP.
XX
AC   FJ594417;
XX
DT   26-JAN-2009 (Rel. 99, Created)
DT   26-JAN-2009 (Rel. 99, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-Cw) gene, HLA-Cw*01 allele, exons 2,
DE   3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-645
RA   Goburdhun Z., Brown J., Patel R., Govender U., Brown C.;
RT   "A novel HLA-Cw*01 allele";
RL   Unpublished.
XX
RN   [2]
RP   1-645
RA   Goburdhun Z., Brown J., Patel R., Govender U., Brown C.;
RT   ;
RL   Submitted (17-DEC-2008) to the INSDC.
RL   H&I, NHSBT, Colindale Avenue, London NW9 5BG, UK
XX
DR   MD5; 02d12ef14dfdd5dccff1caeab20c4f24.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..645
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /note="PCR_primers=fwd_name: C-Forward 5Cin1-66, rev_name:
FT                   C Reverse intron 3 12-35"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>645
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*01"
FT   mRNA            join(<1..270,371..>645)
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*01"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,371..>645)
FT                   /codon_start=3
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*01"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:B9VR41"
FT                   /db_xref="IMGT/HLA:C*01:23"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:B9VR41"
FT                   /protein_id="ACL98474.1"
FT                   /translation="SHSMKYFFTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQKYKRQAQADRVSLRNLRGYYNQSEDGSHTLQWMCGCDLGP
FT                   DGRLLRGYDQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQRRAYLEGTC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*01"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..>645
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*01"
FT                   /number=3
XX
SQ   Sequence 645 BP; 105 A; 169 C; 198 G; 73 T; 100 other;
     gctcccactc catgaagtat ttcttcacat ccgtgtcccg gcctggccgc ggagagcccc        60
     gcttcatctc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccgag aggggagccg cgggcgccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaagtac aagcgccagg cacaggctga ccgagtgagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggacg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ggtctcacac cctccagtgg atgtgtggct gcgacctggg gcccgacggg       420
     cgcctcctcc gcgggtatga ccagtacgcc tacgacggca aggattacat cgccctgaac       480
     gaggacctgc gctcctggac cgccgcggac accgcggctc agatcaccca gcgcaagtgg       540
     gaggcggccc gtgaggcgga gcagcggaga gcctacctgg agggcacgtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gcgcg                       645
//


spacer
spacer