Dbfetch

ID   FJ561482; SV 2; linear; genomic DNA; STD; HUM; 2675 BP.
XX
AC   FJ561482;
XX
DT   23-JAN-2009 (Rel. 99, Created)
DT   28-OCT-2009 (Rel. 102, Last updated, Version 4)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*3818 allele, complete
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2675
RX   DOI; 10.1111/j.1399-0039.2009.01351.x.
RX   PUBMED; 19765260.
RA   Cheng L.H., Zhu W.G., Lan Y.X., Jin S.Z., Zou H.Y.;
RT   "Full length sequence of a novel HLA-B*3818 allele differs from
RT   HLA-B*380201 allele in exon 4 and intron 5";
RL   Tissue Antigens 74(5):439-440(2009).
XX
RN   [2]
RP   1-2675
RA   Cheng L.-H., Zou H.-Y., Jin S.-Z., Li Z., Wang D.-M.;
RT   "A new HLA-B*38 allele observed in Chinese Han";
RL   Unpublished.
XX
RN   [3]
RP   1-2675
RA   Cheng L.-H., Zou H.-Y., Jin S.-Z., Li Z., Wang D.-M.;
RT   ;
RL   Submitted (17-DEC-2008) to the INSDC.
RL   Shenzhen Blood Center, Nigang West Road, Shenzhen, Guangdong 518035, China
XX
RN   [4]
RC   Sequence update by submitter
RP   1-2675
RA   Cheng L.-H., Zou H.-Y., Jin S.-Z., Li Z., Wang D.-M.;
RT   ;
RL   Submitted (04-JUN-2009) to the INSDC.
RL   Shenzhen Blood Center, Nigang West Road, Shenzhen, Guangdong 518035, China
XX
DR   MD5; ae22e41d80d24c40a8646c3f6287c3bb.
XX
CC   On Jun 4, 2009 this sequence version replaced gi:220979418.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2675
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>2675
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*3818"
FT   mRNA            join(<1..73,202..471,718..993,1566..1841,1935..2051,
FT                   2493..2525,2632..>2675)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*3818"
FT                   /product="MHC class I antigen"
FT   CDS             join(1..73,202..471,718..993,1566..1841,1935..2051,
FT                   2493..2525,2632..2675)
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*3818"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:B8YPU7"
FT                   /db_xref="IMGT/HLA:B*38:18"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:B8YPU7"
FT                   /protein_id="ACL97991.1"
FT                   /translation="MLVMAPRTVLLLLSAALALTETWAGSHSMRYFYTSVSRPGRGEPR
FT                   FISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQICKTNTQTYRENLRT
FT                   ALRYYNQSEAGSHTLQRMYGCDVGPDGRLLRGHNQFAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAARVAEQLRTYLEGTCVEWLRRYLENGKETLQRADPPKTHVTHHPISEHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSSGGK
FT                   GGSYSQAASSDSAQGSDVSLTA"
FT   exon            <1..73
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*3818"
FT                   /number=1
FT   exon            202..471
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*3818"
FT                   /number=2
FT   exon            718..993
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*3818"
FT                   /number=3
FT   exon            1566..1841
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*3818"
FT                   /number=4
FT   variation       1606
FT                   /gene="HLA-B"
FT                   /replace="c"
FT                   /note="results in E220D as compared to HLA-B*3802"
FT   exon            1935..2051
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*3818"
FT                   /number=5
FT   exon            2493..2525
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*3818"
FT                   /number=6
FT   exon            2632..>2675
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*3818"
FT                   /number=7
XX
SQ   Sequence 2675 BP; 502 A; 798 C; 842 G; 533 T; 0 other;
     atgctggtca tggcgccccg aaccgtcctc ctgctgctct cggcggccct ggccctgacc        60
     gagacctggg ccggtgagtg cgggtcggga gggaaatggc ctctgccggg aggagcgagg       120
     ggaccgcagg cgggggcgca ggacctgagg agccgcgccg ggaggagggt cgggcgggtc       180
     tcagcccctc ctcgccccca ggctcccact ccatgaggta tttctacacc tccgtgtccc       240
     ggcccggccg cggggagccc cgcttcatct cagtgggcta cgtggacgac acgcagttcg       300
     tgaggttcga cagcgacgcc gcgagtccga gagaggagcc gcgggcgccg tggatagagc       360
     aggaggggcc ggaatattgg gaccggaaca cacagatctg caagaccaac acacagactt       420
     accgagagaa cctgcgcacc gcgctccgct actacaacca gagcgaggcc ggtgagtgac       480
     cccggcccgg ggcgcaggtc acgactcccc atcccccacg tacggcccgg gtcgccccga       540
     gtctccgggt ccgagatccg cctccctgag gccgcgggac ccgcccagac cctcgaccgg       600
     cgagagcccc aggcgcgttt acccggtttc attttcagtt gaggccaaaa tccccgcggg       660
     ttggtcgggg cggggcgggg ctcgggggga cggggctgac cgcggggccg gggccagggt       720
     ctcacaccct ccagaggatg tacggctgcg acgtggggcc ggacgggcgc ctcctccgcg       780
     ggcataacca gttcgcctac gacggcaagg attacatcgc cctgaacgag gacctgagct       840
     cctggaccgc ggcggacacc gcggctcaga tcacccagcg caagtgggag gcggcccgtg       900
     tggcggagca gctgagaacc tacctggagg gcacgtgcgt ggagtggctc cgcagatacc       960
     tggagaacgg gaaggagacg ctgcagcgcg cgggtaccag gggcagtggg gagccttccc      1020
     catctcctat aggtcgccgg ggatggcctc caacgagaag aagaggaaaa tgggatcagc      1080
     gctagaatgt cgccctccct tgaatggaga atggcatgag ttttcctgag tttcctctga      1140
     gggccccctc ttctctctag gacaattaag ggatgacgtc tctgaggaaa tggaggggaa      1200
     gacagtccct agaatactga tcaggggtcc cctttgaccc ctgcagcagc cttgggaacc      1260
     atgacttttc ctctcaggcc ttgttctctg cctcacactc agtgtgtttg gggctctgat      1320
     tccagcactt ctgagtcact ttacctccac tcagatcagg agcagaagtc tctgttcccc      1380
     gctcagagac tcgaactttc caatgaatag attatcccag gtgcctgcgt ccaggctggt      1440
     gtctgggttc tgtgcccctt ccccacccca ggtgtcctgt ccattctcag gctggtcaca      1500
     tgggtggtcc tagggtgtcc catgagagat gcaaagcgcc tgaattttct gactcttccc      1560
     atcagacccc ccaaagacac atgtgaccca ccaccccatc tctgaacatg aggccaccct      1620
     gaggtgctgg gccctgggct tctaccctgc ggagatcaca ctgacctggc agcgggatgg      1680
     cgaggaccaa actcaggaca ccgagcttgt ggagaccaga ccagcaggag acagaacctt      1740
     ccagaagtgg gcagctgtgg tggtgccttc tggagaagag cagagataca catgccatgt      1800
     acagcatgag gggctgccga agcccctcac cctgagatgg ggtaaggagg gggatgaggg      1860
     gtcatatctc ttctcaggga aagcaggagc ccttcagcag ggtcagggcc cctcatcttc      1920
     ccctcctttc ccagagccat cttcccagtc caccgtcccc atcgtgggca ttgttgctgg      1980
     cctggctgtc ctagcagttg tggtcatcgg agctgtggtc gctgctgtga tgtgtaggag      2040
     gaagagttca ggtagggaag gggtgagggg tggggtctgg gttttcttgt cccactgggg      2100
     gtttcaagcc ccaggtagaa gtgttccctg cctcattact gggaagcagc atgcacacag      2160
     gggctaacgc agcctgggac cctgtgtgcc agcacttact cttttgtgca gcacatgtga      2220
     caatgaagga cggatgtatc accttgatgg ttgtggtgtt ggggtcctga ttccagcatt      2280
     catgagtcag gggaaggtcc ctgctaagga cagaccttag gagggcagtt ggtccaggac      2340
     ccacacttgc tttcctcgtg tttcctgatc ctgccctggg tctgtagtca tacttctgga      2400
     aattcctttt gggtccaaga ctaggaggtt cctctaagat ctcatggccc tgcttcctcc      2460
     cagtcccctc acaggacatt ttcttcccac aggtggaaaa ggagggagct actctcaggc      2520
     tgcgtgtaag tggtgggggt gggagtgtgg aggagctcac ccaccccata attcctcctg      2580
     tcccacgtct cctgtgggct ctgaccaggt cctgtttttg ttctactcca gccagcgaca      2640
     gtgcccaggg ctctgatgtg tctctcacag cttga                                 2675
//