spacer

EBI Dbfetch

ID   FJ556895; SV 2; linear; genomic DNA; STD; HUM; 1683 BP.
XX
AC   FJ556895;
XX
DT   08-FEB-2009 (Rel. 99, Created)
DT   12-DEC-2012 (Rel. 115, Last updated, Version 3)
XX
DE   Homo sapiens MHC class I chain-related protein A (MICA) gene, MICA*TW-FHnew
DE   allele, exons 2 through 4 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1683
RX   DOI; 10.1016/j.humimm.2011.03.006.
RX   PUBMED; 21513756.
RA   Tian W., Cai J., Liu X.;
RT   "MICA genetic polymorphism and HLA-A,C,B,MICA and DRB1 haplotypic variation
RT   in a southern Chinese Han population: identification of two new MICA
RT   alleles, MICA*060 and MICA*062";
RL   Hum. Immunol. 72(6):510-515(2011).
XX
RN   [2]
RP   1-1683
RA   Tian W., Cai J.H., Wang F., Li L.X.;
RT   "A new MICA allele identified in a Chinese Han family by sequence-based
RT   typing";
RL   Unpublished.
XX
RN   [3]
RP   1-1683
RA   Tian W., Cai J.H., Wang F., Li L.X.;
RT   ;
RL   Submitted (17-DEC-2008) to the INSDC.
RL   Immunogenetics Research Group, Department of Immunology, College of Basic
RL   Medical Sciences, Central South University, 172 Tongzipo Road, Changsha,
RL   Hunan 410013, P.R. China
XX
DR   MD5; 41522482a4680f6f1e88c7c07d514ddc.
XX
CC   On Apr 14, 2009 this sequence version replaced gi:222355765.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1683
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /note="HLA haplotype segregation in the pedigree: father,
FT                   A1-Cw6-B57-MICA*017-DR7 A2-Cw3-B35-MICA*00201-DR4; mother,
FT                   A2-Cw1-B55-MICA*TW-FH-DR14, A33-Cw3-B58-MICA*00201-DR17;
FT                   son, A2-Cw3-B35-MICA*00201-DR4, A2-Cw1-B55-MICA*TW-FH-DR14"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1683
FT                   /gene="MICA"
FT                   /allele="MICA*TW-FHnew"
FT   mRNA            join(<1..255,530..817,1405..>1683)
FT                   /gene="MICA"
FT                   /allele="MICA*TW-FHnew"
FT                   /product="MHC class I chain-related protein A"
FT   CDS             join(<1..255,530..817,1405..>1683)
FT                   /codon_start=3
FT                   /gene="MICA"
FT                   /allele="MICA*TW-FHnew"
FT                   /product="MHC class I chain-related protein A"
FT                   /db_xref="GOA:B9VJ52"
FT                   /db_xref="IMGT/HLA:MICA*060"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:B9VJ52"
FT                   /protein_id="ACM48568.2"
FT                   /translation="PHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKPQ
FT                   GQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTR
FT                   SSQHFYYDGELFLSQNLETEEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTLYHAMHADC
FT                   LQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSL
FT                   SHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSRNHSTHPVPS"
FT   exon            1..255
FT                   /gene="MICA"
FT                   /allele="MICA*TW-FHnew"
FT                   /number=2
FT   gap             256..529
FT                   /estimated_length=274
FT   exon            530..817
FT                   /gene="MICA"
FT                   /allele="MICA*TW-FHnew"
FT                   /number=3
FT   gap             818..1404
FT                   /estimated_length=587
FT   exon            1405..1683
FT                   /gene="MICA"
FT                   /allele="MICA*TW-FHnew"
FT                   /number=4
FT   variation       1653
FT                   /gene="MICA"
FT                   /replace="g"
XX
SQ   Sequence 1683 BP; 216 A; 218 C; 231 G; 157 T; 861 other;
     agccccacag tcttcgttat aacctcacgg tgctgtcctg ggatggatct gtgcagtcag        60
     ggtttctcac tgaggtacat ctggatggtc agcccttcct gcgctgtgac aggcagaaat       120
     gcagggcaaa gccccaggga cagtgggcag aagatgtcct gggaaataag acatgggaca       180
     gagagaccag agacttgaca gggaacggaa aggacctcag gatgaccctg gctcatatca       240
     aggaccagaa agaagnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnng cttgcattcc       540
     ctccaggaga ttagggtctg tgagatccat gaagacaaca gcaccaggag ctcccagcat       600
     ttctactacg atggggagct cttcctctcc caaaacctgg agactgagga atggacaatg       660
     ccccagtcct ccagagctca gaccttggcc atgaacgtca ggaatttctt gaaggaagat       720
     gccatgaaga ccaagacact ctatcacgct atgcatgcag actgcctgca ggaactacgg       780
     cgatatctaa aatccggcgt agtcctgagg agaacagnnn nnnnnnnnnn nnnnnnnnnn       840
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       900
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       960
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1020
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1080
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1140
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1200
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1260
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1320
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1380
     nnnnnnnnnn nnnnnnnnnn nnnntgcccc ccatggtgaa tgtcacccgc agcgaggcct      1440
     cagagggcaa cattaccgtg acatgcaggg cttctggctt ctatccctgg aatatcacac      1500
     tgagctggcg tcaggatggg gtatctttga gccacgacac ccagcagtgg ggggatgtcc      1560
     tgcctgatgg gaatggaacc taccagacct gggtggccac caggatttgc caaggagagg      1620
     agcagaggtt cacctgctac atggaacaca gcaggaatca cagcactcac cctgtgccct      1680
     ctg                                                                    1683
//


spacer
spacer