Dbfetch

ID   FJ547092; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   FJ547092;
XX
DT   20-JAN-2009 (Rel. 99, Created)
DT   10-JUN-2009 (Rel. 101, Last updated, Version 2)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*04 variant
DE   allele, exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RX   DOI; 10.1111/j.1399-0039.2009.01246.x.
RX   PUBMED; 19392806.
RA   Gao S.Q., Deng Z.H., Xu Y.P.;
RT   "Identification of a novel allele HLA-DRB1*0478 by sequence-based typing in
RT   a Chinese individual";
RL   Tissue Antigens 73(6):625-627(2009).
XX
RN   [2]
RP   1-270
RA   Gao S.-Q., Deng Z.-H., Xun Y.-P.;
RT   ;
RL   Submitted (12-DEC-2008) to the INSDC.
RL   Shenzhen Institute of Transfusion Medicine, Shenzhen Blood Center, Nigang
RL   West Road, Meigang Nan Street, Shenzhen, Guangdong 518035, China
XX
DR   MD5; 6cfb30965a0c3a2770b52538f41ddd75.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /country="China"
FT                   /isolation_source="Han individual"
FT                   /note="amplified with S4R2 and S4R4 primer pairs of
FT                   Protrans S4 commercial kit"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*04 variant"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*04 variant"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*04 variant"
FT                   /product="MHC class II antigen"
FT                   /note="human leukocyte antigen DRB1"
FT                   /db_xref="GOA:B8YM95"
FT                   /db_xref="IMGT/HLA:DRB1*04:78"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:B8YM95"
FT                   /protein_id="ACL80124.1"
FT                   /translation="RFLEQVKHECHFFNGTERVRFLDRYFYHQEESVRFDSDVGEYRAV
FT                   TELGRPDAEYWNSQKDLLERRRAEVDTYCRHNYGVVESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*04 variant"
FT                   /number=2
FT   variation       196
FT                   /gene="HLA-DRB1"
FT                   /replace="a"
FT                   /note="results in arginine to glutamine substitution"
XX
SQ   Sequence 270 BP; 58 A; 65 C; 99 G; 48 T; 0 other;
     cacgtttctt ggagcaggtt aaacatgagt gtcatttctt caacgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tatcaccaag aggagtccgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacctcct ggagcggagg cgggccgagg tggacaccta ctgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcgag                                        270
//