spacer

EBI Dbfetch

ID   FJ542024; SV 1; linear; genomic DNA; STD; HUM; 3029 BP.
XX
AC   FJ542024;
XX
DT   23-JAN-2009 (Rel. 99, Created)
DT   25-SEP-2009 (Rel. 102, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-Cw) gene, HLA-Cw*02NEW allele,
DE   complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3029
RX   DOI; 10.1111/j.1399-0039.2009.01324.x.
RX   PUBMED; 19775374.
RA   Serov Y., Hommel-Berrey G., Lobashevsky A.;
RT   "Identification of a novel HLA-C allele, Cw*021602, by sequence-based
RT   typing in a family of German descent";
RL   Tissue Antigens 74(4):349-350(2009).
XX
RN   [2]
RP   1-3029
RA   Serov Y.A., Hommel-Berrey G.A., Lobashevsky A.L.;
RT   ;
RL   Submitted (10-DEC-2008) to the INSDC.
RL   Medicine, Indiana University (IUPUI), Riley Hospital, Room 0615, 702
RL   Barnhill Drive, Indianapolis, IN 46202, USA
XX
DR   MD5; 117c55e59cdf735f8e4600c677295e86.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3029
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>3029
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*02NEW"
FT   mRNA            join(<1..179,310..579,825..1100,1688..1963,2085..2204,
FT                   2644..2676,2784..2831,2996..>3029)
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*02NEW"
FT                   /product="MHC class I antigen"
FT   exon            <1..179
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*02NEW"
FT                   /number=1
FT   5'UTR           <1..106
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*02NEW"
FT   CDS             join(107..179,310..579,825..1100,1688..1963,2085..2204,
FT                   2644..2676,2784..2831,2996..3000)
FT                   /codon_start=1
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*02NEW"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:B8YJM6"
FT                   /db_xref="IMGT/HLA:C*02:16:02"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:B8YJM6"
FT                   /protein_id="ACL82596.1"
FT                   /translation="MRVMAPRTLLLLLSGALALTETWACSHSMRYFYTAVSRPSRGEPH
FT                   FIAVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQTDRVNLRK
FT                   LRGYYNQSEAGSHTLQRMYGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKWEAAREAEQLRAYLEGECVEWLRRYLENGKETLQRAEHPKTHVTHHPVSDHE
FT                   ATLRCWALGFYPTEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPEPLTLRWEPSSQPTIPIVGIVAGLAVLAVLAVLGAVVAVVMCRRKSSGG
FT                   KGGSCSQAASSNSAQGSDESLIACKA"
FT   exon            310..579
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*02NEW"
FT                   /number=2
FT   exon            825..1100
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*02NEW"
FT                   /number=3
FT   exon            1688..1963
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*02NEW"
FT                   /number=4
FT   exon            2085..2204
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*02NEW"
FT                   /number=5
FT   exon            2644..2676
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*02NEW"
FT                   /number=6
FT   exon            2784..2831
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*02NEW"
FT                   /number=7
FT   exon            2996..>3029
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*02NEW"
FT                   /number=8
FT   3'UTR           3001..>3029
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*02NEW"
XX
SQ   Sequence 3029 BP; 570 A; 878 C; 964 G; 617 T; 0 other;
     ctcccattgg gtgtcgggtt ctagagaagc caatcagcgt ctccgcagtc ccggttctaa        60
     agtccccagt cacccacccg gactcggatt ctccccagac gccgagatgc gggtcatggc       120
     gccccgaacc ctcctcctgc tgctctcggg agccctggcc ctgaccgaga cctgggcctg       180
     tgagtgcggg gttgggaggg aaacggcctc tgcggagagg agcgaggggc ccgcccggcg       240
     agggcgcagg acccggggag ccgcgcaggg aggagggtcg ggcgggtctc agcccctcct       300
     ctcccccagg ctcccactcc atgaggtatt tctacaccgc tgtgtcccgg cccagccgcg       360
     gagagcccca cttcatcgca gtgggctacg tggacgacac gcagttcgtg cggttcgaca       420
     gcgacgccgc gagtccaaga ggggagccgc gggcgccgtg ggtggagcag gaggggccgg       480
     agtattggga ccgggagaca cagaagtaca agcgccaggc acagactgac cgagtgaacc       540
     tgcggaaact gcgcggctac tacaaccaga gcgaggccgg tgagtgaccc cggcccgggg       600
     cgcaggtcac gacccctccc catcccccac ggacggcccg ggtcgccccg agtctccggg       660
     tctgagatcc accccgaggc tgcggaaccc gcccagaccc tcgaccggag agagccccag       720
     tcacctttac ccggtttcgt tttcagttta ggccaaaatc cccgcgggtt ggtcggggct       780
     ggggcggggc tcgggggacg ggctgaccac gggggcgggg ccagggtctc acaccctcca       840
     gaggatgtac ggctgcgacc tggggcccga cgggcgcctc ctccgcgggt atgaccagtc       900
     cgcctacgac ggcaaggatt acatcgccct gaacgaggac ctgcgctcct ggaccgccgc       960
     ggacacagcg gctcagatca cccagcgcaa gtgggaggcg gcccgtgagg cggagcagct      1020
     gagagcctac ctggagggcg agtgcgtgga gtggctccgc agatacctgg agaacgggaa      1080
     ggagacgctg cagcgcgcgg gtaccagggg cagtggggag ccttccccat ctcctgtaga      1140
     tctcccggga tggcctccca cgaggagggg aggaaaatgg gatcagcgct agaatatcgc      1200
     cctcccttga atggagaatg ggatgagttt tcctgagttt cctctgaggg ccccctctgc      1260
     tctctaggac aattaaggga tgaagtcctt gaggaaatgg aggggaagac agtccctgga      1320
     atactgatca ggggtcccct ttgaccactt tgaccactgc agcagctgtg gtcaggctgc      1380
     tgacctttct ctcaggcctt gttctctgcc tcacgctcaa tgtgtttgaa ggtttgattc      1440
     cagcttttct gagtccttcg gcctccactc aggtcaggac cagaagtcgc tgttcctccc      1500
     tcagagacta gaactttcca atgaatagga gattatccca ggtgcctgtg tccaggctgg      1560
     cgtctgggtt ctgtgccccc ttccccaccc caggtgtcct gtccattctc aggatagtca      1620
     catgggcgct gttggagtgt cgcaagagag atacaaagtg tctgaatttt ctgactcttc      1680
     ccgtcagaac acccaaagac acacgtgacc caccatcccg tctctgacca tgaggccacc      1740
     ctgaggtgct gggccctggg cttctaccct acggagatca cactgacctg gcagcgggat      1800
     ggcgaggacc aaactcagga caccgagctt gtggagacca ggccagcagg agatggaacc      1860
     ttccagaagt gggcagctgt ggtggtgcct tctggagaag agcagagata cacgtgccat      1920
     gtgcagcacg aggggctgcc ggagcccctc accctgagat ggggtaagga gggggatgag      1980
     gggtcatgtg tcttctcagg gaaagcagaa gtcctggagc ccttcagctg ggtcagggct      2040
     gaggcttggg ggtcagggcc cctcaccttc ccctcctttc ccagagccat cttcccagcc      2100
     caccatcccc atcgtgggca tcgttgctgg cctggctgtc ctggctgtcc tagctgtcct      2160
     aggagctgtg gtggctgttg tgatgtgtag gaggaagagc tcaggtaggg aaggggtggg      2220
     gagtggggtc tgggttttct tgttccactg ggagtttcaa gccccaggta gaagtgtgcc      2280
     ccacctcgtt actggaagca ccatccacac atgggccatc ccagcctggg accctgtgtg      2340
     ccagcactta ctctgttgtg aagcacatga caatgaagga cagatgtatc accttgatga      2400
     ttatggtgtt ggggtccttg attccagcat tcatgagtca ggggaaggtc cctgctaagg      2460
     acagacctta ggagggcagt tgctccagaa cccacagctg ctttccccgt gtttcctgat      2520
     cctgccctgg gtctgcagtc atagttctgg aaacttctct tgggtccaag actaggaggt      2580
     tcccctaaga tcgcatggcc ctgactcctc cctgtcccct cacagggcat tttcttccca      2640
     caggtggaaa aggagggagc tgctctcagg ctgcgtgtaa gtgatggcgg tgggcgtgtg      2700
     gaggagctca cccgccccat aattcctctt gtcccacatc tcctgcgggc tctgaccagg      2760
     tctttttttt tgttctaccc cagccagcaa cagtgcccag ggctctgatg agtctctcat      2820
     cgcttgtaaa ggtgagattc tggggagctg aagtggtcgg gggtggggca gagggaaaag      2880
     gcctaggtaa tggggatcct ttgattggga cgtttcgaat gtgtggtgag ctgttcagag      2940
     tgtgatcact taccatgact gacctgaatt tgttcatgac tattgtgttc tgtagcctga      3000
     gacagctgcc tgtgtgggac tgagatgca                                        3029
//


spacer
spacer