spacer

EBI Dbfetch

ID   FJ518827; SV 1; linear; genomic DNA; STD; HUM; 276 BP.
XX
AC   FJ518827;
XX
DT   24-DEC-2008 (Rel. 98, Created)
DT   07-APR-2013 (Rel. 116, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*2301 allele, exon 4
DE   and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-276
RX   PUBMED; 23347090.
RA   Wang D., Liu N., Wang L., Li W., Zhang Z.;
RT   "Two new HLA alleles, HLA-A*23:20 and HLA-A*02:127 identified in Chinese
RT   individuals";
RL   Tissue Antigens 81(3):172-173(2013).
XX
RN   [2]
RP   1-276
RA   Zhang Z., Shan X., Li W.;
RT   "Identification of a novel allele by sequence-base typing";
RL   Unpublished.
XX
RN   [3]
RP   1-276
RA   Zhang Z., Shan X., Li W.;
RT   ;
RL   Submitted (16-NOV-2008) to the INSDC.
RL   HLA Lab, Beijing Red Cross Blood Center, 37 North Third Ring Road, Beijing
RL   100088, China
XX
DR   MD5; 0580f689f8331189dacf699bf2d65007.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..276
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>276
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2301"
FT   mRNA            <1..>276
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2301"
FT                   /product="MHC class I antigen"
FT   CDS             <1..>276
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2301"
FT                   /product="MHC class I antigen"
FT                   /db_xref="IMGT/HLA:A*23:20"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:B7UE87"
FT                   /protein_id="ACK44105.1"
FT                   /translation="PPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDT
FT                   ELVETRPAGDGTFQKWVAVVVPSGEEQRYTCHVQHEGLPKPLTLRW"
FT   exon            <1..>276
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2301"
FT                   /number=4
FT   variation       187
FT                   /gene="HLA-A"
FT                   /replace="c"
FT                   /note="V245A"
XX
SQ   Sequence 276 BP; 62 A; 84 C; 85 G; 45 T; 0 other;
     acccccccaa gacacatatg acccaccacc ccatctctga ccatgaggcc actctgagat        60
     gctgggccct gggcttctac cctgcggaga tcacactgac ctggcagcgg gatggggagg       120
     accagaccca ggacacggag cttgtggaga ccaggcctgc aggggatgga accttccaga       180
     agtgggtagc tgtggtggta ccttctggag aggagcagag atacacctgc catgtgcagc       240
     atgagggtct gcccaagccc ctcaccctga gatggg                                 276
//


spacer
spacer