spacer

EBI Dbfetch

ID   FJ515903; SV 2; linear; genomic DNA; STD; HUM; 4537 BP.
XX
AC   FJ515903;
XX
DT   13-JAN-2009 (Rel. 99, Created)
DT   28-OCT-2009 (Rel. 102, Last updated, Version 3)
XX
DE   Homo sapiens MHC class I antigen (HLA-Cw) gene, HLA-Cw*030401 variant
DE   allele, promoter region and complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-4537
RA   Xu Y., Deng Z., Zeng J.;
RT   "HLA-Cw full length cloning and sequencing: Sequence analysis from 5'
RT   upstream region through 3' downstream region";
RL   Unpublished.
XX
RN   [2]
RP   1-4537
RA   Xu Y., Deng Z., Zeng J.;
RT   ;
RL   Submitted (03-DEC-2008) to the INSDC.
RL   Immunogenetic Laboratory, Shenzhen Blood Center, MeiGang South Street,
RL   NiGang West Road, Shenzhen, Guangdong 518035, China
XX
RN   [3]
RC   Sequence update by submitter
RP   1-4537
RA   Xu Y., Deng Z., Zeng J.;
RT   ;
RL   Submitted (18-FEB-2009) to the INSDC.
RL   Immunogenetic Laboratory, Shenzhen Blood Center, MeiGang South Street,
RL   NiGang West Road, Shenzhen, Guangdong 518035, China
XX
DR   MD5; 35230a9ece017d2dfb6ba132d3288042.
DR   Ensembl-Gn; ENSG00000225691; homo_sapiens.
DR   Ensembl-Tr; ENST00000457903; homo_sapiens.
XX
CC   On Feb 18, 2009 this sequence version replaced gi:219816049.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4537
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /note="PCR_primers=fwd_name: HLA-CwF, rev_name: HLA-CwR"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>4537
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*030401 variant"
FT   misc_feature    <1..961
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*030401 variant"
FT                   /note="contains promoter and 5' UTR"
FT   mRNA            join(<962..1034,1165..1434,1680..1955,2543..2818,
FT                   2940..3059,3499..3531,3639..3686,3851..>4537)
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*030401 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(962..1034,1165..1434,1680..1955,2543..2818,2940..3059,
FT                   3499..3531,3639..3686,3851..3855)
FT                   /codon_start=1
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*030401 variant"
FT                   /product="MHC class I antigen"
FT                   /note="glycoprotein; major histocompatibility complex"
FT                   /db_xref="GOA:Q53YP1"
FT                   /db_xref="IMGT/HLA:C*03:04:01:02"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q53YP1"
FT                   /protein_id="ACL37147.1"
FT                   /translation="MRVMAPRTLILLLSGALALTETWAGSHSMRYFYTAVSRPGRGEPH
FT                   FIAVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRN
FT                   LRGYYNQSEAGSHIIQRMYGCDVGPDGRLLRGYDQYAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKWEAAREAEQLRAYLEGLCVEWLRRYLKNGKETLQRAEHPKTHVTHHPVSDHE
FT                   ATLRCWALGFYPAEITLTWQWDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPEPLTLRWEPSSQPTIPIVGIVAGLAVLAVLAVLGAVVAVVMCRRKSSGG
FT                   KGGSCSQAASSNSAQGSDESLIACKA"
FT   3'UTR           3856..>4537
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*030401 variant"
XX
SQ   Sequence 4537 BP; 929 A; 1233 C; 1358 G; 1017 T; 0 other;
     gcaactttga ggtgatgact acaggctccc ggttgcaata gacagtaaca aaccctgctt        60
     ctttgtattc aggagatgtt ctggactcac acagggaaac tctggctaga gaatgaggat       120
     aactttaaat gcaacaaccc agagtcacag atccatagtc tgcgaaagta aaacaggagc       180
     tttgagaatt taattgtaat gcagttttga cacaggtctt tcacagattg gaattctaat       240
     cattcaggga ttaccaatat tgtgctacct actgtatcaa taaacaaaaa ggaaactggt       300
     ctctatgaga atctctacct ggtgctttca gacaaaactt caccaggttt aaagagaaaa       360
     ctcctgactc tacacgtcca ttcacagggc gagctcactg tctggcatca agttccccat       420
     ggtgagtttc cctgtacaag agtccaaggg gagaggtaag tgtcctttat tttgctggat       480
     gtagtttaat attacctgag gtaaggtaag gcaaagagtg ggaggcaggg agtccagttc       540
     agggacgggg attccaggag aagtgaaggg gaaggggctg ggcgcagcct gggggtctct       600
     ccctggtttc cacagacaga tccttggcca ggactcaggc acacagtgtg acaaagatgc       660
     ttggtgtagg agaagaggaa tcaggacgaa gtcccaggtc ccgggcgggg ctctcagggt       720
     ctcaggctcc aagggccgtg tctgcactgg ggaggcgccg cgttgaggat tctccactcc       780
     cctgagtttc acttcttctc ccaacctgcg tcgggtcctt cttcctgaat actcatgacg       840
     cgtccccaat tcccactccc attgggtgtc ggattctaga gaagccaatc agcgtctccg       900
     cagtcccggt tctgaagtcc ccagtcaccc acccggactc agattctccc cagacgccga       960
     gatgcgggtc atggcgcccc gaaccctcat cctgctgctc tcgggagccc tggccctgac      1020
     cgagacctgg gccggtgagt gcggggttgg gagggaatcg gcctctgcgg agaggagcga      1080
     ggggcccgcc cggcgagggc gcaggacccg gggagccgcg cagggaggag ggtcgggcgg      1140
     gtctcagccc ctcctcgccc ccaggctccc actccatgag gtatttctac accgctgtgt      1200
     cccggcccgg ccgcggggag ccccacttca tcgcagtggg ctacgtggac gacacgcagt      1260
     tcgtgcggtt cgacagcgac gccgcgagtc cgagagggga gccgcgggcg ccgtgggtgg      1320
     agcaggaggg gccggagtat tgggaccggg agacacagaa gtacaagcgc caggcacaga      1380
     ctgaccgagt gagcctgcgg aacctgcgcg gctactacaa ccagagcgag gccggtgagt      1440
     gaccccggcc cggggcgcag gtcacgaccc ctcctcatcc cccacggacg gcccgggtcg      1500
     ccccaagtct cccggtctga gatccacccc gaggctgcgg aacccgccca gaccctcgac      1560
     cggagagagc cccagtcacc tttacccggt ttcattttca gtttaggcca aaatccccgc      1620
     gggttggtcg gggcggggcg gggctcgggg gacggggctg accgcggggg cggggccagg      1680
     gtctcacatc atccagagga tgtatggctg cgacgtgggg cccgacgggc gcctcctccg      1740
     cgggtatgac cagtacgcct acgacggcaa ggattacatc gccctgaacg aggatctgcg      1800
     ctcctggacc gccgcggaca cggcggctca gatcacccag cgcaagtggg aggcggcccg      1860
     tgaggcggag cagctgagag cctacctgga gggcctgtgc gtggagtggc tccgcagata      1920
     cctgaagaat gggaaggaga cgctgcagcg cgcgggtacc aggggcagtg gggagccttc      1980
     cccatctcct gtagatctcc cgggatggcc tcccacgagg aggggaggaa aatgggatca      2040
     gcgctagaat atcgccctcc cttgaatgga gaatgggatg agttttcctg agtttcctct      2100
     gagggccccc tctgctctct aggacaatta agggatgaag tccttgagga aatggagggg      2160
     aagacagtcc ctagaatact gatcaggggt cccctttgac cactttgacc actgcagcag      2220
     ctgtggtcag gctgctgacc tttctctcag gccttgttct ctgcctcacg ctcaatgtgt      2280
     ttgaaggttt gattccagct tttctgagtc cttcggcctc cactcaggtc aggaccagaa      2340
     gtcgctgttc ctccctcaga gactagaact ttccaatgaa taggagatta tcccaggtgc      2400
     ctgtgtccag gctggcgtct gggttctgtg cccccttccc caccccaggt gtcctgtccg      2460
     ttctcaggat ggtcacatgg gcgctgttgg agtgtcgcaa gagagataca aagtgtctga      2520
     attttctgac tcttcccgtc agaacaccca aagacacacg tgacccacca tcccgtctct      2580
     gaccatgagg ccaccctgag gtgctgggcc ctgggcttct accctgcgga gatcacactg      2640
     acctggcagt gggatgggga ggaccaaact caggacactg agcttgtgga gaccaggcca      2700
     gcaggagatg gaaccttcca gaagtgggca gctgtggtgg tgccttctgg agaagagcag      2760
     agatacacgt gccatgtgca gcacgagggg ctgccggagc ccctcaccct gagatggggt      2820
     aaggaggggg atgaggggtg atgtgtcttc tcagggaaag cagaagtcct ggagcccttc      2880
     agccaggtca gggctgaggc ttgggggtca gggcccctca ccttcccctc ctttcccaga      2940
     gccgtcttcc cagcccacca tccccatcgt gggcatcgtt gctggcctgg ctgtcctggc      3000
     tgtcctagct gtcctaggag ctgtggtggc tgttgtgatg tgtaggagga agagctcagg      3060
     tagggaaggg gtgaggagtg gggtctgggt tttcttgttc cactgggagt ttcaagcccc      3120
     aggtagaagt gtgccccacc tcgttactgg aagcaccatc cacacatggg ccatcccagc      3180
     ctgggaccct gtgtgccagc acttactctg ttgtgaagca catgacaatg aaggacagat      3240
     gtatcacctt gatgattatg gtgttggggt ccttgattcc agcattcatg agtcagggga      3300
     aggtccctgc taaggacaga ccttaggagg gcagttgctc cagaacccac agctgctttc      3360
     cccgtgtttc ctgatcctgc cctgggtctg cagtcatagt tctggaaact tctcttgggt      3420
     ccaagactag gaggttcccc taagatcgca tggccctgac tcctccctgt cccctcacag      3480
     ggcattttct tcccacaggt ggaaaaggag ggagctgctc tcaggctgcg tgtaagtgat      3540
     ggcggtgggc gtgtggagga gctcacccac cccataattc ctcttgtccc acatctcctg      3600
     cgggctctga ccaggtcttt ttttttgttc taccccagcc agcaacagtg cccagggctc      3660
     tgatgagtct ctcatcgctt gtaaaggtga gattctgggg agctgaagtg gtcgggggtg      3720
     gggcagaggg aaaaggccta ggtaatgggg atcctttgat tgggacgttt cgaatgtgtg      3780
     gtgagctgtt cagagtgtga tcacttacca tgactgacct gaatttgttc atgactattg      3840
     tgttctgtag cctgagacag ctgcctgtgt gggactgaga tgcaggattt cttcacacct      3900
     ctcctttgtg acttcaagag cctctggcat ctctttctgc aaaggcatct gaatgtgtct      3960
     gcgttcctgt tagcataatg tgaggaggtg gacagacagc ccacccccgt gtccaccgtg      4020
     acccctgtcc ccacactgac ctgtgttccc tccccgatca tctttcctgt tccagagaag      4080
     tgggctggat gtctccatct ctgtctcaac ttcatggtgc gctgagctgc aacttcttac      4140
     ttccctaatg aagttaggaa cctgaatata aatttgtttt ctcaaatatt tgctatgaag      4200
     ggttgatgga ttaattaaat aagtcaattc ctggaagttg agagagcaaa taaagacctg      4260
     agaactttcc agaatccgca tgttctctgt gctgagtctg ttgcaggtgg gggtggggaa      4320
     ggctgtgagg agccgagtgt ggacgggggc ctgtgcctag ttgctgttca gttcttcatg      4380
     ggctttatgt agtcagtcct tagctgggtc accttcactg ctccattgtc cttgtccctt      4440
     cagtggaaac ttgtccagca ggagctgtga ccacagaggc tcacacatcg cccagggcag      4500
     cccctgcaca cgggagtccc tgtgctttct gagacaa                               4537
//


spacer
spacer