spacer

EBI Dbfetch

ID   FJ515276; SV 1; linear; genomic DNA; STD; HUM; 652 BP.
XX
AC   FJ515276;
XX
DT   15-JAN-2009 (Rel. 99, Created)
DT   15-JAN-2009 (Rel. 99, Last updated, Version 1)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB3) gene, HLA-DRB3*02New allele,
DE   exons 2, 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-652
RA   Westerink N., Bacelar M., Arts-Hilkes Y., Mulder W., Rozemuller E.H.;
RT   "A new HLA-DRB3*02 allele identified by sequencing based typing";
RL   Unpublished.
XX
RN   [2]
RP   1-652
RA   Westerink N., Bacelar M., Arts-Hilkes Y., Mulder W., Rozemuller E.H.;
RT   ;
RL   Submitted (03-DEC-2008) to the INSDC.
RL   Genome Diagnostics B.V., Yalelaan 48, Utrecht 3584CM, the Netherlands
XX
DR   MD5; 0805a2abb264c81edd55550c123a3a7b.
DR   Ensembl-Gn; ENSG00000196101; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230463; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231679; homo_sapiens.
DR   Ensembl-Tr; ENST00000307137; homo_sapiens.
DR   Ensembl-Tr; ENST00000383126; homo_sapiens.
DR   Ensembl-Tr; ENST00000426847; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..652
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.4"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="W153"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>652
FT                   /map="6p21.3"
FT                   /gene="HLA-DRB3"
FT                   /allele="HLA-DRB3*02New"
FT   mRNA            join(<1..270,371..>652)
FT                   /gene="HLA-DRB3"
FT                   /allele="HLA-DRB3*02New"
FT                   /product="MHC class II antigen"
FT   CDS             join(<1..270,371..>652)
FT                   /codon_start=3
FT                   /gene="HLA-DRB3"
FT                   /allele="HLA-DRB3*02New"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:P79483"
FT                   /db_xref="HGNC:HGNC:4951"
FT                   /db_xref="IMGT/HLA:DRB3*02:24"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:2Q6W"
FT                   /db_xref="PDB:3C5J"
FT                   /db_xref="PDB:4H1L"
FT                   /db_xref="UniProtKB/Swiss-Prot:P79483"
FT                   /protein_id="ACL50609.1"
FT                   /translation="RFLELLKSECHFFNGTERVRFLERHFHNQEEYARFDSDVGEYRAV
FT                   RELGRPDAEYWNSQKDLLEQKRGQVDNYCRHNYGVVESFTVQRRVHPQVTVYPAKTQPL
FT                   QHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSG
FT                   EVYTCQVEHPSVTSPLTVEW"
FT   exon            1..270
FT                   /gene="HLA-DRB3"
FT                   /allele="HLA-DRB3*02New"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..652
FT                   /gene="HLA-DRB3"
FT                   /allele="HLA-DRB3*02New"
FT                   /number=3
XX
SQ   Sequence 652 BP; 124 A; 139 C; 183 G; 106 T; 100 other;
     cacgtttctt ggagctgctt aagtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga gagacacttc cataaccagg aggagtacgc gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgagg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacctcct ggagcagaag cggggccagg tggacaatta ctgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcgag nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn tccatcctca ggtgactgtg tatcctgcaa agacccagcc cctgcagcac       420
     cacaacctcc tggtctgctc tgtgagtggt ttctatccag gcagcattga agtcaggtgg       480
     ttccggaacg gccaggaaga gaaggctggg gtggtgtcca cgggcctgat ccagaatgga       540
     gactggacct tccagaccct ggtgatgcta gaaacagttc ctcggagtgg agaggtttac       600
     acctgccaag tggagcaccc aagcgtaacg agccctctca cagtggaatg ga               652
//


spacer
spacer