spacer

EBI Dbfetch

ID   FJ481086; SV 2; linear; genomic DNA; STD; HUM; 579 BP.
XX
AC   FJ481086;
XX
DT   24-DEC-2008 (Rel. 98, Created)
DT   30-AUG-2009 (Rel. 102, Last updated, Version 4)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*1218 allele,
DE   introns 1 and 2, exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-579
RX   DOI; 10.1111/j.1399-0039.2009.01294.x.
RX   PUBMED; 19508407.
RA   Gao S.Q., Deng Z.H., Xu Y.P.;
RT   "Identification of a novel HLA-DRB1*12 allele, DRB1*1218, in Chinese
RT   population";
RL   Tissue Antigens 74(3):265-267(2009).
XX
RN   [2]
RP   1-579
RA   Gao S.-Q., Deng Z.-H., Xun Y.-P.;
RT   ;
RL   Submitted (20-NOV-2008) to the INSDC.
RL   Shenzhen Institute of Transfusion Medicine, Shenzhen Blood Center, Nigang
RL   Xi Road, Meigang Nan Street, Shenzhen, Guangdong 518035, China
XX
DR   MD5; 71f57a06d943484758d64b8ca8884652.
DR   Ensembl-Gn; ENSG00000206240; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206306; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228080; homo_sapiens.
DR   Ensembl-Tr; ENST00000328980; homo_sapiens.
DR   Ensembl-Tr; ENST00000399450; homo_sapiens.
DR   Ensembl-Tr; ENST00000412634; homo_sapiens.
DR   Ensembl-Tr; ENST00000415796; homo_sapiens.
DR   Ensembl-Tr; ENST00000419393; homo_sapiens.
DR   Ensembl-Tr; ENST00000428566; homo_sapiens.
XX
CC   On Feb 18, 2009 this sequence version replaced gi:218456536.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..579
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /sex="female"
FT                   /note="PCR_primers=fwd_name: S4R6, rev_name: S4R8"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>579
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1218"
FT   intron          <1..256
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1218"
FT                   /number=1
FT   mRNA            <257..>526
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1218"
FT                   /product="MHC class II antigen"
FT   CDS             <257..>526
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1218"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q95IE3"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*12:18"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q95IE3"
FT                   /protein_id="ACK77491.1"
FT                   /translation="RFLEYSTGECYFFNGTERVRLLERHFHNQEELLRFDSDVGEFRAV
FT                   TELGRPVAQSWNSQKDFLEDRRAAVDTYCRHNYGAVESFTVQRR"
FT   exon            257..526
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1218"
FT                   /number=2
FT   variation       418
FT                   /gene="HLA-DRB1"
FT                   /replace="g"
FT                   /note="Q59E"
FT   intron          527..>579
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1218"
FT                   /number=2
XX
SQ   Sequence 579 BP; 98 A; 155 C; 217 G; 109 T; 0 other;
     aacaggctgg aggtagggac gggggtccca aaagcctggg gatcagacgt ggttttcccg        60
     cctggtcccc caggcccccg ttcgcctcag gaagacggag gatgagctcc tgggctgcag       120
     gtggtgggcg ttgcgggtgg ggccggttaa ggttcccagt gcctgcaccc cacccaggga       180
     gccccggatg gtggcgtcgc tgtcagtgtc ttctcaggag gccacctgtg tgactggatc       240
     gttcgtgtcc ccacagcacg tttcttggag tactctacgg gtgagtgtta tttcttcaat       300
     gggacggagc gggtgcggtt actggagaga cacttccata accaggagga gctcctgcgc       360
     ttcgacagcg acgtggggga gttccgggcg gtgacggagc tggggcggcc tgtcgcccag       420
     tcctggaaca gccagaagga cttcctggaa gacaggcgcg ccgcggtgga cacctattgc       480
     agacacaact acggggctgt ggagagcttc acagtgcagc ggcgaggtga gcgcggcgcg       540
     gggcggggcc tgagtccctg tgagctggga atctgagtg                              579
//


spacer
spacer