spacer

EBI Dbfetch

ID   FJ463035; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   FJ463035;
XX
DT   24-DEC-2008 (Rel. 98, Created)
DT   24-DEC-2008 (Rel. 98, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*27new allele, partial
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Li W., Shan X., Liu N., Wang L., He X., Cui S., Zhao B., Gong Z., Wang L.,
RA   Ni L., Zhang Z.;
RT   "A novel allele identified by sequence-based techniques";
RL   Unpublished.
XX
RN   [2]
RP   1-270
RA   Li W., Shan X., Liu N., Wang L., He X., Cui S., Zhao B., Gong Z., Wang L.,
RA   Ni L., Zhang Z.;
RT   ;
RL   Submitted (14-NOV-2008) to the INSDC.
RL   HLA Lab, Beijing Red Cross Blood Center, No 37 North Third Ring Road,
RL   Beijing 100088, China
XX
DR   MD5; 5372cfc3fbb4cb1da54e84c3b2de02c0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6q21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*27new"
FT   mRNA            <1..>270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*27new"
FT                   /product="MHC class I antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*27new"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:B7U9X4"
FT                   /db_xref="IMGT/HLA:B*27:44"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:B7U9X4"
FT                   /protein_id="ACJ74045.1"
FT                   /translation="SHSMRYFHTSVSRPGRGEPRFITVGYVDDTLFVRFDSDAASPREE
FT                   PRAPWIEQEGPEYWDRETQICKAKAQTYRESLRNLRGYYNQSEA"
FT   variation       219
FT                   /gene="HLA-B"
FT                   /replace="g"
FT                   /note="results in tyrosine to aspartic acid substitution"
XX
SQ   Sequence 270 BP; 55 A; 85 C; 94 G; 36 T; 0 other;
     gctcccactc catgaggtat ttccacacct ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcac cgtgggctac gtggacgaca cgctgttcgt gaggttcgac agcgacgccg       120
     cgagtccgag agaggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accgggagac acagatctgc aaggccaagg cacagactta ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg                                        270
//


spacer
spacer