spacer

EBI Dbfetch

ID   FJ460464; SV 1; linear; genomic DNA; STD; HUM; 1647 BP.
XX
AC   FJ460464;
XX
DT   25-MAR-2009 (Rel. 100, Created)
DT   25-MAR-2009 (Rel. 100, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-G) gene, HLA-G*010117 allele, partial
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1647
RX   DOI; 10.1111/j.1399-0039.2009.01229.x.
RX   PUBMED; 19317754.
RA   Lajoie J., Boivin A.A., Jeanneau A., Faucher M.C., Roger M.;
RT   "Identification of six new HLA-G alleles with non-coding DNA base changes";
RL   Tissue Antigens 73(4):379-380(2009).
XX
RN   [2]
RP   1-1647
RA   Lajoie J., Boivin A.A., Jeanneau A., Faucher M.C., Roger M.;
RT   ;
RL   Submitted (12-NOV-2008) to the INSDC.
RL   Laboratoire Immunogenetique, Centre de Recherche du Centre Hospitalier de
RL   l'Universite de Montreal, 2099 Alexandre de Seve Y-5608, Montreal, Quebec
RL   H2L2W5, Canada
XX
DR   MD5; 2f004c12b3d27af9c0352aaf4dc98a71.
DR   Ensembl-Gn; ENSG00000204632; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206506; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230413; homo_sapiens.
DR   Ensembl-Gn; ENSG00000233095; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235346; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235680; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237216; homo_sapiens.
DR   Ensembl-Tr; ENST00000360323; homo_sapiens.
DR   Ensembl-Tr; ENST00000376828; homo_sapiens.
DR   Ensembl-Tr; ENST00000383621; homo_sapiens.
DR   Ensembl-Tr; ENST00000400665; homo_sapiens.
DR   Ensembl-Tr; ENST00000400682; homo_sapiens.
DR   Ensembl-Tr; ENST00000420559; homo_sapiens.
DR   Ensembl-Tr; ENST00000422371; homo_sapiens.
DR   Ensembl-Tr; ENST00000423011; homo_sapiens.
DR   Ensembl-Tr; ENST00000423373; homo_sapiens.
DR   Ensembl-Tr; ENST00000428701; homo_sapiens.
DR   Ensembl-Tr; ENST00000428952; homo_sapiens.
DR   Ensembl-Tr; ENST00000434881; homo_sapiens.
DR   Ensembl-Tr; ENST00000444098; homo_sapiens.
DR   Ensembl-Tr; ENST00000449127; homo_sapiens.
DR   Ensembl-Tr; ENST00000450984; homo_sapiens.
DR   Ensembl-Tr; ENST00000546545; homo_sapiens.
DR   Ensembl-Tr; ENST00000546634; homo_sapiens.
DR   Ensembl-Tr; ENST00000547241; homo_sapiens.
DR   Ensembl-Tr; ENST00000547931; homo_sapiens.
DR   Ensembl-Tr; ENST00000550897; homo_sapiens.
DR   Ensembl-Tr; ENST00000553052; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1647
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1647
FT                   /gene="HLA-G"
FT                   /allele="HLA-G*010117"
FT   mRNA            join(<1..270,499..774,1372..>1647)
FT                   /gene="HLA-G"
FT                   /allele="HLA-G*010117"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,499..774,1372..>1647)
FT                   /codon_start=3
FT                   /gene="HLA-G"
FT                   /allele="HLA-G*010117"
FT                   /product="MHC class I antigen"
FT                   /note="human leukocyte antigen G"
FT                   /db_xref="GOA:C0JSV3"
FT                   /db_xref="IMGT/HLA:G*01:01:17"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:C0JSV3"
FT                   /protein_id="ACN92041.1"
FT                   /translation="SHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRME
FT                   PRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGS
FT                   DGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTC
FT                   VEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGED
FT                   QTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRW"
FT   gap             271..498
FT                   /estimated_length=228
FT   gap             775..1371
FT                   /estimated_length=597
XX
SQ   Sequence 1647 BP; 172 A; 241 C; 281 G; 128 T; 825 other;
     gctcccactc catgaggtat ttcagcgccg ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc catgggctac gtggacgaca cgcagttcgt gcggttcgac agcgactcgg       120
     cgtgtccgag gatggagccg cgggcgccgt gggtggagca ggaggggcca gagtattggg       180
     aagaggagac acggaacacc aaggcccacg cacagactga cagaatgaac ctgcagaccc       240
     tgcgcggcta ctacaaccag agcgaggcca nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnngt tctcataccc tccagtggat gattggttgc gacctggggt       540
     ccgacggacg cctcctccgc gggtatgaac agtatgccta cgatggcaag gattacctcg       600
     ccctgaacga ggacctgcgc tcctggaccg cagcggacac tgcggctcag atctccaagc       660
     gcaagtgtga ggcggccaat gtggctgaac aaaggagagc ctacctggag ggcacgtgcg       720
     tggagtggct ccacagatac ctggagaacg ggaaggagat gctgcagcgc gcggnnnnnn       780
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       840
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       900
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       960
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1020
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1080
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1140
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1200
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1260
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1320
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn naccccccca      1380
     agacacacgt gacccaccac cctgtctttg actatgaggc caccctgagg tgctgggccc      1440
     tgggcttcta ccctgcggag atcatactga cctggcagcg ggatggggag gaccagaccc      1500
     aggacgtgga gctcgtggag accaggcctg caggggatgg aaccttccag aagtgggcag      1560
     ctgtggtggt gccttctgga gaggagcaga gatacacgtg ccatgtgcag catgaggggc      1620
     tgccggagcc cctcatgctg agatgga                                          1647
//


spacer
spacer