spacer

EBI Dbfetch

ID   FJ442950; SV 1; linear; genomic DNA; STD; HUM; 300 BP.
XX
AC   FJ442950;
XX
DT   16-DEC-2008 (Rel. 98, Created)
DT   30-AUG-2009 (Rel. 102, Last updated, Version 2)
XX
DE   Homo sapiens isolate K9701_DR9V MHC class II antigen (HLA-DRB1) gene, exon
DE   2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-300
RX   DOI; 10.1111/j.1399-0039.2009.01292.x.
RX   PUBMED; 19531102.
RA   Chu C.C., Lee H.L., Lin M.;
RT   "A novel HLA-DRB1 allele, DRB*090202, is identified in a Taiwanese family";
RL   Tissue Antigens 74(3):262-263(2009).
XX
RN   [2]
RP   1-300
RA   Chu C.-C.;
RT   ;
RL   Submitted (06-NOV-2008) to the INSDC.
RL   Medical Research Department, Mackay Memorial Hospital, Taiwan
XX
DR   MD5; 3f99d3aa6574c9027b9f5ca7a7ad69b3.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..300
FT                   /organism="Homo sapiens"
FT                   /isolate="K9701_DR9V"
FT                   /mol_type="genomic DNA"
FT                   /country="Taiwan"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>300
FT                   /gene="HLA-DRB1"
FT   mRNA            <21..>290
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT   CDS             <21..>290
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT                   /note="major histocompatibility complex"
FT                   /db_xref="GOA:B7U794"
FT                   /db_xref="IMGT/HLA:DRB1*09:02:02"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:B7U794"
FT                   /protein_id="ACJ64202.1"
FT                   /translation="RFLKQDKFECHFFNGTERVRYLHRGIYNQEENVRFDSDVGEYRAV
FT                   TELGRPDAEYWNSQKDFLERRRAEVDTVCRHNYGVGESFTVQRR"
FT   exon            21..290
FT                   /gene="HLA-DRB1"
FT                   /number=2
XX
SQ   Sequence 300 BP; 68 A; 68 C; 110 G; 54 T; 0 other;
     gatccttcgt gtccccacag cacgtttctt gaagcaggat aagtttgagt gtcatttctt        60
     caacgggacg gagcgggtgc ggtatctgca cagaggcatc tataaccaag aggagaacgt       120
     gcgcttcgac agcgacgtgg gggagtaccg ggcggtgacg gagctggggc ggcctgatgc       180
     cgagtactgg aacagccaga aggacttcct ggagcggagg cgggccgagg tggacaccgt       240
     gtgcagacac aactacgggg ttggtgagag cttcacagtg cagaggcgag gtaagcatgg       300
//


spacer
spacer