Dbfetch

ID   FJ434674; SV 1; linear; genomic DNA; STD; HUM; 1819 BP.
XX
AC   FJ434674;
XX
DT   16-DEC-2008 (Rel. 98, Created)
DT   16-DEC-2008 (Rel. 98, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-C) gene, HLA-Cw17 allele, complete
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1819
RA   Balas A., Garcia-Sanchez F., Vicario J.L.;
RT   "Sequencing of a new HLA-C allele";
RL   Unpublished.
XX
RN   [2]
RP   1-1819
RA   Balas A., Garcia-Sanchez F., Vicario J.L.;
RT   ;
RL   Submitted (03-NOV-2008) to the INSDC.
RL   Histocompatibility, CTM, Avenida de la Democracia, Madrid 28032, Spain
XX
DR   MD5; 4192e9347a9eda15b2afc345d23aabaa.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1819
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1819
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw17"
FT   mRNA            join(<1..73,174..443,544..819,920..1195,1296..1433,
FT                   1534..1566,1667..1714,1815..>1819)
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw17"
FT                   /product="MHC class I antigen"
FT   CDS             join(1..73,174..443,544..819,920..1195,1296..1433,
FT                   1534..1566,1667..1714,1815..1819)
FT                   /codon_start=1
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw17"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:B7U5E0"
FT                   /db_xref="IMGT/HLA:C*17:05"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:B7U5E0"
FT                   /protein_id="ACJ64928.1"
FT                   /translation="MRVMAPQALLLLLSGALALIETWAGSHSMRYFYTAVSRPGRGEPR
FT                   FIAVGYVDDTQFVQFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQADRVNLRK
FT                   LRGYYNQSEAGSHTIQRMYGCDLGPDGRLLRGYNQFAYDGKDYIALNEDLRSWTAADTA
FT                   AQISQRKLEAAREAEQLRAYLEGECVEWLRGYLENGKETLQRAERPKTHVTHHPVSDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRY
FT                   TCHVQHEGLQEPCTLRWKPSSQPTIPNLGIVSGPAVLAVLAVLAVLAVLGAVVAAVIHR
FT                   RKSSGGKGGSCSQAASSNSAQGSDESLIACKA"
FT   gap             74..173
FT                   /estimated_length=unknown
FT   gap             444..543
FT                   /estimated_length=unknown
FT   gap             820..919
FT                   /estimated_length=unknown
FT   gap             1196..1295
FT                   /estimated_length=unknown
FT   gap             1434..1533
FT                   /estimated_length=unknown
FT   gap             1567..1666
FT                   /estimated_length=unknown
FT   gap             1715..1814
FT                   /estimated_length=unknown
XX
SQ   Sequence 1819 BP; 220 A; 343 C; 376 G; 180 T; 700 other;
     atgcgggtca tggcgcccca agccctcctc ctgctgctct cgggagccct ggccctgatc        60
     gagacctggg ccgnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       120
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnngctccca       180
     ctccatgagg tatttctaca ccgccgtgtc ccggcccggc cgcggagagc cccgcttcat       240
     cgcagtgggc tacgtggacg acacgcagtt cgtgcagttc gacagcgacg ccgcgagtcc       300
     gagaggggag ccgcgggcgc cgtgggtgga gcaggagggg ccggagtatt gggaccggga       360
     gacacagaag tacaagcgcc aggcacaggc tgaccgagtg aacctgcgga aactgcgcgg       420
     ctactacaac cagagcgagg ccgnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       540
     nnngttctca caccatccag aggatgtatg gctgcgacct ggggcccgac gggcgcctcc       600
     tccgcgggta taaccagttc gcctacgacg gcaaggatta catcgccctg aacgaggacc       660
     tgcgctcctg gaccgcggcg gacacggcgg ctcagatctc ccagcgcaag ttggaggcgg       720
     cccgtgaggc ggagcagctg agagcctacc tggagggcga gtgcgtggag tggctccgcg       780
     gatacctgga gaacgggaag gagacgctgc agcgcgcggn nnnnnnnnnn nnnnnnnnnn       840
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       900
     nnnnnnnnnn nnnnnnnnna acgcccaaag acacacgtga cccaccatcc cgtctctgac       960
     catgaggcca ccctgaggtg ctgggccctg ggcttctacc ctgcggagat cacactgacc      1020
     tggcagcggg atggggagga ccaaactcag gacaccgagc ttgtggagac caggccagca      1080
     ggagatggaa ccttccagaa gtgggcagct gtggtggtgc cttctggaca agaacagaga      1140
     tacacgtgcc atgtgcagca cgaggggctg caggagccct gcaccctgag atggannnnn      1200
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1260
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnagccg tcttcccagc ccaccatccc      1320
     caacttgggc atcgtttctg gcccagctgt cctggctgtc ctggctgtcc tggctgtcct      1380
     agctgtccta ggagctgtgg tcgctgctgt gatacatagg aggaagagct cagnnnnnnn      1440
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1500
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnngtggaaa aggagggagc tgctctcagg      1560
     ctgcgtnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1620
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnccag caacagtgcc      1680
     cagggctctg atgagtctct catcgcttgt aaagnnnnnn nnnnnnnnnn nnnnnnnnnn      1740
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1800
     nnnnnnnnnn nnnncctga                                                   1819
//