Dbfetch

ID   FJ428239; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   FJ428239;
XX
DT   16-DEC-2008 (Rel. 98, Created)
DT   07-APR-2013 (Rel. 116, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*24new allele, exon 2
DE   and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RX   PUBMED; 23278434.
RA   Liu N., Zhang Z., Shan X., Ni L., Wang L.;
RT   "A novel HLA-A allele, A*24:02:17, identified by sequence-based typing";
RL   Tissue Antigens 81(2):119-120(2013).
XX
RN   [2]
RP   1-270
RA   Liu N., Shan X., Li W., Wang L., Cang L., Cui S., Gong Z., Zhao B., Ni L.,
RA   He X., Zhang Z.;
RT   "A novel allele identified by sequence-based strategies";
RL   Unpublished.
XX
RN   [3]
RP   1-270
RA   Liu N., Shan X., Li W., Wang L., Cang L., Cui S., Gong Z., Zhao B., Ni L.,
RA   He X., Zhang Z.;
RT   ;
RL   Submitted (30-OCT-2008) to the INSDC.
RL   HLA Lab, Beijing Red Cross Blood Center, No 37 North Third Ring Road,
RL   Beijing 100088, China
XX
DR   MD5; 7eaf1f89b79e5370509a30cb80e9f984.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6q21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24new"
FT   mRNA            <1..>270
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24new"
FT                   /product="MHC class I antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24new"
FT                   /product="MHC class I antigen"
FT                   /db_xref="IMGT/HLA:A*24:02:17"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:B7U3W8"
FT                   /protein_id="ACJ24536.1"
FT                   /translation="SHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEA"
FT   exon            1..270
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24new"
FT                   /number=2
FT   variation       191
FT                   /gene="HLA-A"
FT                   /replace="a"
FT                   /note="as compared to HLA-A*240201"
XX
SQ   Sequence 270 BP; 54 A; 84 C; 96 G; 36 T; 0 other;
     gctcccactc catgaggtat ttctccacat ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     acgaggagac ggggaaagtg aaggcccact cacagactga ccgagagaac ctgcggatcg       240
     cgctccgcta ctacaaccag agcgaggccg                                        270
//