spacer

EBI Dbfetch

ID   FJ428230; SV 1; linear; genomic DNA; STD; HUM; 276 BP.
XX
AC   FJ428230;
XX
DT   29-DEC-2008 (Rel. 98, Created)
DT   07-APR-2013 (Rel. 116, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*24new allele, exon 3
DE   and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-276
RX   PUBMED; 22897448.
RA   Wang L., Zhixin Z., Xiaoyan S., Zhao B., Gong Z.;
RT   "Identification of the novel HLA-A allele, HLA-A*24:96, in a Chinese
RT   individual";
RL   Tissue Antigens 80(5):462-463(2012).
XX
RN   [2]
RP   1-276
RA   Shan X., He X., Wang L., Liu N., Li W., Wang L., Ni L., Gong Z., Zhao B.,
RA   Cui S., Zhang Z.;
RT   "A novel allele identified by sequence-based strategies";
RL   Unpublished.
XX
RN   [3]
RP   1-276
RA   Shan X., He X., Wang L., Liu N., Li W., Wang L., Ni L., Gong Z., Zhao B.,
RA   Cui S., Zhang Z.;
RT   ;
RL   Submitted (30-OCT-2008) to the INSDC.
RL   HLA Lab, Beijing Red Cross Blood Center, No 37 North Third Ring Road,
RL   Beijing 100088, China
XX
DR   MD5; 1c27f2b6b2d6df7bf506143f1dbf2452.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..276
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6q21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>276
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24new"
FT   mRNA            <1..>276
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24new"
FT                   /product="MHC class I antigen"
FT   CDS             <1..>276
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24new"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:B8XRE9"
FT                   /db_xref="IMGT/HLA:A*24:96"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:B8XRE9"
FT                   /protein_id="ACJ37467.1"
FT                   /translation="SHTLQMMFGCDVGSDGRFLRGYNQFAYDGKDYIALKEDLRSWTAA
FT                   DMAAQITKRKWEAAHVAEQQRAYLEGTCVDGLRRYLENGKETLQRT"
FT   exon            1..276
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24new"
FT                   /number=3
FT   variation       68
FT                   /gene="HLA-A"
FT                   /replace="c"
FT                   /note="as compared to HLA-A*240201"
FT   variation       69
FT                   /gene="HLA-A"
FT                   /replace="c"
FT                   /note="as compared to HLA-A*240201"
FT   variation       76
FT                   /gene="HLA-A"
FT                   /replace="a"
FT                   /note="as compared to HLA-A*240201"
XX
SQ   Sequence 276 BP; 56 A; 79 C; 99 G; 42 T; 0 other;
     gttctcacac cctccagatg atgtttggct gcgacgtggg gtcggacggg cgcttcctcc        60
     gcgggtataa ccagttcgcc tacgacggca aggattacat cgccctgaaa gaggacctgc       120
     gctcttggac cgcggcggac atggcggctc agatcaccaa gcgcaagtgg gaggcggccc       180
     atgtggcgga gcagcagaga gcctacctgg agggcacgtg cgtggacggg ctccgcagat       240
     acctggagaa cgggaaggag acgctgcagc gcacgg                                 276
//


spacer
spacer