spacer

EBI Dbfetch

ID   FJ411059; SV 1; linear; genomic DNA; STD; HUM; 1642 BP.
XX
AC   FJ411059;
XX
DT   29-DEC-2008 (Rel. 98, Created)
DT   29-DEC-2008 (Rel. 98, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*27new allele, exons 2
DE   through 4 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1642
RA   Cheng S., Zhang B., Xing P., Du G., Du J., Ma R., Kong D., Wang Y.;
RT   "Human MHC Class I Antigen (HLA)";
RL   Unpublished.
XX
RN   [2]
RP   1-1642
RA   Cheng S., Zhang B., Xing P., Du G., Du J., Ma R., Kong D., Wang Y.;
RT   ;
RL   Submitted (23-OCT-2008) to the INSDC.
RL   Transfusion Institute, Henan Red Cross Blood Center, 9 Tongle Road,
RL   Zhengzhou, Henan 450012, China
XX
DR   MD5; 35aed70fa724e1260f9fb04c8fd800f8.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1642
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1642
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*27new"
FT   mRNA            join(<1..270,512..787,1367..>1642)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*27new"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,512..787,1367..>1642)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*27new"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:B8XPR9"
FT                   /db_xref="IMGT/HLA:B*27:45"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:B8XPR9"
FT                   /protein_id="ACJ38680.1"
FT                   /translation="SHSMRYFHTSVSRPGRGEPRFITVGYVDDTLFVRFDSDAASPREE
FT                   PRAPWIEQEGPEYWDRETQICKAKAQTDREDLRTLLRYYNQSEAGSHTLQNMYGCDVGP
FT                   DGRLLRGYHQDAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQRRAYLEGEC
FT                   VEWLRRYLENGKETLQRADPPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*27new"
FT                   /number=2
FT   gap             271..511
FT                   /estimated_length=241
FT   exon            512..787
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*27new"
FT                   /number=3
FT   gap             788..1366
FT                   /estimated_length=579
FT   exon            1367..1642
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*27new"
FT                   /number=4
XX
SQ   Sequence 1642 BP; 175 A; 256 C; 279 G; 112 T; 820 other;
     gctcccactc catgaggtat ttccacacct ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcac cgtgggctac gtggacgaca cgctgttcgt gaggttcgac agcgacgccg       120
     cgagtccgag agaggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accgggagac acagatctgc aaggccaagg cacagactga ccgagaggac ctgcggaccc       240
     tgctccgcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nggtctcaca ccctccagaa tatgtatggc       540
     tgcgacgtgg ggccggacgg gcgcctcctc cgcgggtacc accaggacgc ctacgacggc       600
     aaggattaca tcgccctgaa cgaggacctg agctcctgga ccgccgcgga cacggcggct       660
     cagatcaccc agcgcaagtg ggaggcggcc cgtgtggcgg agcagcggag agcctacctg       720
     gagggcgagt gcgtggagtg gctccgcaga tacctggaga acgggaagga gacgctgcag       780
     cgcgcggnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       840
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       900
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       960
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1020
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1080
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1140
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1200
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1260
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1320
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnaccc cccaaagaca      1380
     cacgtgaccc accaccccgt ctctgaccat gaggccaccc tgaggtgctg ggccctgggc      1440
     ttctaccctg cggagatcac actgacctgg cagcgggatg gcgaggacca aactcaggac      1500
     actgagcttg tggagaccag accagcagga gatagaacct tccagaagtg ggcagctgtg      1560
     gtggtgcctt ctggagaaga gcagagatac acatgccatg tacagcatga ggggctgccg      1620
     aagcccctca ccctgagatg gg                                               1642
//


spacer
spacer