Dbfetch

ID   FJ374890; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   FJ374890;
XX
DT   06-NOV-2008 (Rel. 97, Created)
DT   01-MAY-2014 (Rel. 120, Last updated, Version 3)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*40variant allele, exon
DE   2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RX   DOI; 10.1111/j.1399-0039.2009.01339.x.
RX   PUBMED; 19845900.
RA   Zhang Y., Lu H.X., Liu Y., Zhu C.F.;
RT   "A novel HLA-B allele, B*4096 was identified by sequence-based typing in a
RT   Chinese individual";
RL   Tissue Antigens 74(5):440-442(2009).
XX
RN   [2]
RP   1-270
RA   Zhu C., Nie X., Zhang Y., He W., Fang Y., Liu Y.;
RT   "Identification of a novel HLA-B*4006";
RL   Unpublished.
XX
RN   [3]
RP   1-270
RA   Zhu C., Nie X., Zhang Y., He W., Fang Y., Liu Y.;
RT   ;
RL   Submitted (08-OCT-2008) to the INSDC.
RL   HLA Lab, Blood Center of Shandong Province, No.22 East Shanshi Road, Jinan,
RL   ShanDong 250014, P.R. China
XX
DR   MD5; 6922c8060be952ecd81c371543636ea4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40variant"
FT   mRNA            <1..>270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40variant"
FT                   /product="MHC class I antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:B6VCX3"
FT                   /db_xref="IMGT/HLA:B*40:96"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:B6VCX3"
FT                   /protein_id="ACJ09137.2"
FT                   /translation="SHSMRYFHTSVSRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKE
FT                   PRAPWIEQEGPEYWDRETQISKTNTQTYRENLRTALRYYNQSEA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40variant"
FT                   /number=2
XX
SQ   Sequence 270 BP; 59 A; 90 C; 85 G; 36 T; 0 other;
     gctcccactc catgaggtat ttccacacct ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcac cgtgggctac gtggacgaca cgctgttcgt gaggttcgac agcgacgcca       120
     cgagtccgag gaaggagccg cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accgggagac acagatctcc aagaccaaca cacagactta ccgagagaac ctgcgcaccg       240
     cgctccgcta ctacaaccag agcgaggccg                                        270
//