spacer

EBI Dbfetch

ID   FJ358707; SV 1; linear; genomic DNA; STD; HUM; 276 BP.
XX
AC   FJ358707;
XX
DT   03-NOV-2008 (Rel. 97, Created)
DT   03-NOV-2008 (Rel. 97, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*39new allele, exon 4
DE   and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-276
RA   Li W., Shan X., Wang L., Liu N., He X., Ni L., Gong Z., Zhao B., Cui S.,
RA   Wang L., Zhang Z.;
RT   "A novel allele identified by sequence";
RL   Unpublished.
XX
RN   [2]
RP   1-276
RA   Li W., Shan X., Wang L., Liu N., He X., Ni L., Gong Z., Zhao B., Cui S.,
RA   Wang L., Zhang Z.;
RT   ;
RL   Submitted (06-OCT-2008) to the INSDC.
RL   HLA Lab, Beijing Red Cross Blood Center, No 37 North Third Ring Road,
RL   Beijing 100088, China
XX
DR   MD5; 4828f63aa9a8a88e4f33592ec32facac.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..276
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6q21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>276
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*39new"
FT   mRNA            <1..>276
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*39new"
FT                   /product="MHC class I antigen"
FT   CDS             <1..>276
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*39new"
FT                   /product="MHC class I antigen"
FT                   /db_xref="IMGT/HLA:B*39:46"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:B6VAW4"
FT                   /protein_id="ACJ04569.1"
FT                   /translation="PPKTHVTHDPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDT
FT                   ELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW"
FT   exon            1..276
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*39new"
FT                   /number=4
FT   variation       27
FT                   /gene="HLA-B"
FT                   /replace="c"
FT                   /note="results in aspartic acid to histidine substitution"
XX
SQ   Sequence 276 BP; 68 A; 84 C; 83 G; 41 T; 0 other;
     accccccaaa gacacatgtg acccacgacc ccatctctga ccatgaggcc accctgaggt        60
     gctgggccct gggcttctac cctgcggaga tcacactgac ctggcagcgg gatggcgagg       120
     accaaactca ggacaccgag cttgtggaga ccagaccagc aggagacaga accttccaga       180
     agtgggcagc tgtggtggtg ccttctggag aagagcagag atacacatgc catgtacagc       240
     atgaggggct gccgaagccc ctcaccctga gatggg                                 276
//


spacer
spacer