spacer

EBI Dbfetch

ID   FJ358622; SV 1; linear; genomic DNA; STD; HUM; 788 BP.
XX
AC   FJ358622;
XX
DT   27-APR-2010 (Rel. 104, Created)
DT   27-APR-2010 (Rel. 104, Last updated, Version 1)
XX
DE   Homo sapiens clone A-222-00192 MHC class I antigen (HLA-A) gene, exons 2, 3
DE   and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-788
RA   Cereb N., Yang S.Y.;
RT   "HLA new alleles found by Histogenetics";
RL   Unpublished.
XX
RN   [2]
RP   1-788
RA   Cereb N., Yang S.Y.;
RT   ;
RL   Submitted (06-OCT-2008) to the INSDC.
RL   Histogenetics, 300 Executive Blvd., Ossining, NY 10562, USA
XX
DR   MD5; 9f56429691298248a93f6cad2f1b7abf.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..788
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /clone="A-222-00192"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>788
FT                   /gene="HLA-A"
FT   mRNA            join(<1..270,513..>788)
FT                   /gene="HLA-A"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,513..>788)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:D5FIF5"
FT                   /db_xref="IMGT/HLA:A*31:01:04"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:D5FIF5"
FT                   /protein_id="ACO87716.1"
FT                   /translation="SHSMRYFTTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQERPEYWDQETRNVKAHSQIDRVDLGTLRGYYNQSEAGSHTIQMMYGCDVGS
FT                   DGRFLRGYQQDAYDGKDYIALNEDLRSWTAADMAAQITQRKWEAARVAEQLRAYLEGTC
FT                   VEWLRRYLENGKETLQRT"
FT   exon            1..270
FT                   /gene="HLA-A"
FT                   /number=2
FT   gap             271..512
FT                   /estimated_length=242
FT   exon            513..788
FT                   /gene="HLA-A"
FT                   /number=3
XX
SQ   Sequence 788 BP; 108 A; 161 C; 196 G; 81 T; 242 other;
     gctcccactc catgaggtat ttcaccacat ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc tgtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggagaggcct gagtattggg       180
     accaggagac acggaatgtg aaggcccact cacagattga ccgagtggac ctggggaccc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nngttctcac accatccaga tgatgtatgg       540
     ctgcgacgtg gggtcggacg ggcgcttcct ccgcgggtac cagcaggacg cctacgacgg       600
     caaggattac atcgccttga acgaggacct gcgctcttgg accgcggcgg acatggcggc       660
     tcagatcacc cagcgcaagt gggaggcggc ccgtgtggcg gagcagttga gagcctacct       720
     ggagggcacg tgcgtggagt ggctccgcag atacctggag aacgggaagg agacgctgca       780
     gcgcacgg                                                                788
//


spacer
spacer