spacer

EBI Dbfetch

ID   FJ346318; SV 1; linear; genomic DNA; STD; HUM; 788 BP.
XX
AC   FJ346318;
XX
DT   09-OCT-2009 (Rel. 102, Created)
DT   09-OCT-2009 (Rel. 102, Last updated, Version 1)
XX
DE   Homo sapiens clone B_216_00492 MHC class I antigen (HLA-B) gene, exons 2, 3
DE   and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-788
RA   Cereb N., Yang S.Y.;
RT   "HLA new alleles found by histogenetics";
RL   Unpublished.
XX
RN   [2]
RP   1-788
RA   Cereb N., Yang S.Y.;
RT   ;
RL   Submitted (08-APR-2009) to the INSDC.
RL   Histogenetics, 300 Executive Blvd., Ossining, NY 10562, USA
XX
DR   MD5; 36b67f6212d86d3f80c5bc8963e71e44.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..788
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /clone="B_216_00492"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>788
FT                   /gene="HLA-B"
FT   mRNA            join(<1..270,513..>788)
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,513..>788)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:C9WCY7"
FT                   /db_xref="IMGT/HLA:B*35:08:04"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:C9WCY7"
FT                   /protein_id="ACO82516.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTE
FT                   PRAPWIEQEGPEYWDRNTQIFKTNTQTYRESLRNLRGYYNQSEAGSHIIQRMYGCDLGP
FT                   DGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQRRAYLEGLC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /number=2
FT   gap             271..512
FT                   /estimated_length=242
FT   exon            513..788
FT                   /gene="HLA-B"
FT                   /number=3
XX
SQ   Sequence 788 BP; 113 A; 174 C; 187 G; 72 T; 242 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag gacggagccc cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accggaacac acagatcttc aagaccaaca cacagactta ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnggtctcac atcatccaga ggatgtatgg       540
     ctgcgacctg gggcccgacg ggcgcctcct ccgcgggcat gaccagtccg cctacgacgg       600
     caaggattac atcgccctga acgaggacct gagctcctgg accgcggcgg acaccgcggc       660
     tcagatcacc cagcgcaagt gggaggcggc ccgtgtggcg gagcagcgga gagcctacct       720
     ggagggcctg tgcgtggagt ggctccgcag atacctggag aacgggaagg agacgctgca       780
     gcgcgcag                                                                788
//


spacer
spacer