spacer

EBI Dbfetch

ID   FJ236989; SV 1; linear; genomic DNA; STD; HUM; 792 BP.
XX
AC   FJ236989;
XX
DT   21-OCT-2008 (Rel. 97, Created)
DT   12-DEC-2012 (Rel. 115, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-Cw) gene, HLA-Cw-*06 new allele,
DE   exons 2, 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-792
RX   DOI; 10.1016/j.humimm.2009.06.011.
RX   PUBMED; 19539002.
RA   Cordovado S.K., Hancock L.N., Hendrix M., Greene C.N., Mueller P.W.;
RT   "Novel human leukocyte antigen class I and class II alleles identified by
RT   sequence-based typing in the Genetics of Kidneys in Diabetes (GoKinD) study
RT   population";
RL   Hum. Immunol. 70(9):747-749(2009).
XX
RN   [2]
RP   1-792
RA   Hendrix M., Cordovado S.K., Mueller P.W.;
RT   ;
RL   Submitted (25-SEP-2008) to the INSDC.
RL   NCEH/DLS/NSMBB/MRAL, Centers for Disease Control and Prevention, 4770
RL   Buford Highway MS F-24, Atlanta, GA 30341, USA
XX
DR   MD5; 1a35bb740870daaa3e379ab7990d8a69.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..792
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>792
FT                   /gene="HLA-Cw"
FT                   /allele="*06 new"
FT   mRNA            join(<1..270,517..>792)
FT                   /gene="HLA-Cw"
FT                   /allele="*06 new"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,517..>792)
FT                   /codon_start=3
FT                   /gene="HLA-Cw"
FT                   /allele="*06 new"
FT                   /product="MHC class I antigen"
FT                   /note="antigen presenting molecule"
FT                   /db_xref="GOA:B6V6K3"
FT                   /db_xref="IMGT/HLA:C*06:19"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:B6V6K3"
FT                   /protein_id="ACI62420.1"
FT                   /translation="SHSMRYFDTAVSRPGRGEPRFISVGYVNDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQKYKRQAQADRVNLRKLRGYYNQSEDGSHTLQWMYGCDLGP
FT                   DGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQWRAYLEGTC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-Cw"
FT                   /allele="*06 new"
FT                   /number=2
FT   gap             271..516
FT                   /estimated_length=246
FT   exon            517..792
FT                   /gene="HLA-Cw"
FT                   /allele="*06 new"
FT                   /number=3
XX
SQ   Sequence 792 BP; 107 A; 170 C; 199 G; 70 T; 246 other;
     gctcccactc catgaggtat ttcgacaccg ccgtgtcccg gcccggccgc ggagagcccc        60
     gcttcatctc agtgggctac gtgaacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccgag aggggagccc cgggcgccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaagtac aagcgccagg cacaggctga ccgagtgaac ctgcggaaac       240
     tgcgcggcta ctacaaccag agcgaggacg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnggtc tcacaccctc cagtggatgt       540
     atggctgcga cctggggccc gacgggcgcc tcctccgcgg gtatgaccag tccgcctacg       600
     acggcaagga ttacatcgcc ctgaacgagg acctgcgctc ctggaccgcc gcggacacgg       660
     cggctcagat cacccagcgc aagtgggagg cggcccgtga ggcggagcag tggagagcct       720
     acctggaggg cacgtgcgtg gagtggctcc gcagatacct ggagaacggg aaggagacgc       780
     tgcagcgcgc gg                                                           792
//


spacer
spacer