spacer

EBI Dbfetch

ID   FJ231109; SV 1; linear; genomic DNA; STD; HUM; 1971 BP.
XX
AC   FJ231109;
XX
DT   15-OCT-2008 (Rel. 97, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*44new allele, exons 1
DE   through 5 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1971
RA   Martin L.S., Eller S.R., Iglehart B.S., Leffell M.S.;
RT   "Identification of a novel allele: HLA-B*44New";
RL   Unpublished.
XX
RN   [2]
RP   1-1971
RA   Martin L.S., Eller S.R., Iglehart B.S., Leffell M.S.;
RT   ;
RL   Submitted (23-SEP-2008) to the INSDC.
RL   Medicine, Johns Hopkins University, 2041 E. Monument St., Baltimore, MD
RL   21205, USA
XX
DR   MD5; 8bd6fe50e7affe209c807d077c55e35c.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1971
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1971
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44new"
FT   mRNA            join(<1..51,181..450,695..970,1546..1821,1915..>1971)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44new"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..51,181..450,695..970,1546..1821,1915..>1971)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44new"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:B6ED01"
FT                   /db_xref="IMGT/HLA:B*44:65"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:B6ED01"
FT                   /protein_id="ACI43064.1"
FT                   /translation="LLLLLWGAVALTETWAGSHSMRYFYTAMSRPGRGEPRFITVGYVD
FT                   DTLFVRFDSDATSPRKEPRAPWIEQEGPEYWDRETQISKTNTQTYRENLRTALRYYNQS
FT                   EAGSHTLQRMYGCDVGPDGRLLRGYDQDAYDGKDYIALNEDLSSWTAADTAAQITQRKW
FT                   EAARVAEQLRAYLEGLCVESLRRYLENGKETLQRADPPKTHVTHHPISDHEVTLRCWAL
FT                   GFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEG
FT                   LPKPLTLRWEPSSQSTVPIVGIVAGLAV"
FT   exon            <1..51
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44new"
FT                   /number=1
FT   exon            181..450
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44new"
FT                   /number=2
FT   exon            695..970
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44new"
FT                   /number=3
FT   exon            1546..1821
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44new"
FT                   /number=4
FT   exon            1915..>1971
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44new"
FT                   /number=5
XX
SQ   Sequence 1971 BP; 369 A; 615 C; 641 G; 346 T; 0 other;
     ccctcctcct gctgctctgg ggggcagtgg ccctgaccga gacctgggcc ggtgagtgcg        60
     gggtcgggag ggaaatggcc tctgtgggga ggagagaggg gaccgcaggc gggggcgcag       120
     gacccgggga gccgcgccgg gaggagggtc gggcgggtct cagcccctcc tcgcccccag       180
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc       240
     gcttcatcac cgtgggctac gtggacgaca cgctgttcgt gaggttcgac agcgacgcca       300
     cgagtccgag gaaggagccg cgggcgccat ggatagagca ggaggggccg gagtattggg       360
     accgggagac acagatctcc aagaccaaca cacagactta ccgagagaac ctgcgcaccg       420
     cgctccgcta ctacaaccag agcgaggccg gtgagtgacc ccggcccggg gcgcaggtca       480
     cgactcccca tcccccacgt acggcccggg tcgccccgag tctccgggtc cgagatccgc       540
     ccccgaggcc gcgggacccg cccagaccct cgaccggcga gagccccagg cgcgtttacc       600
     cggtttcatt ttcagttgag gccaaaatcc ccgcgggttg gtcggggcgg ggcggggctc       660
     ggggggacgg ggctgaccgc ggggccgggg ccagggtctc acaccctcca gaggatgtac       720
     ggctgcgacg tggggccgga cgggcgcctc ctccgcgggt atgaccagga cgcctacgac       780
     ggcaaggatt acatcgccct gaacgaggac ctgagctcct ggaccgcggc ggacaccgcg       840
     gctcagatca cccagcgcaa gtgggaggcg gcccgtgtgg cggagcagct gagagcctac       900
     ctggagggcc tgtgcgtgga gtcgctccgc agatacctgg agaacgggaa ggagacgctg       960
     cagcgcgcgg gtaccagggg cagtggggag ccttccccat ctcctatagg tcgccgggga      1020
     tggcctccca cgagaagagg aggaaaatgg gatcagcgct agaatgtcgc cctcccttga      1080
     atggagaatg gcatgagttt tcctgagttt cctctgaggg ccccctcttc tctctaggac      1140
     aattaaggga tgacgtctct gaggaaatgg aggggaagac agtccctaga atactgatca      1200
     ggggtcccct ttgacccctg cagcagcctt gggaaccgtg acttttcctc tcaggccttg      1260
     ttctctgcct cacactcagt gtgtttgggg ctctgattcc agcacttctg agtcacttta      1320
     cctccactca gatcaggagc agaagtccct gttccccgct cagagactcg aactttccaa      1380
     tgaataggag attatcccag gtgcctgcgt ccaggctggt gtctgggttc tgtgcccctt      1440
     ccccacccca ggtgtcctgt ccattctcag gctggtcaca tgggtggtcc tagggtgtcc      1500
     catgagagat gcaaagcgcc tgaattttct gactcttccc atcagacccc ccaaagacac      1560
     atgtgaccca ccaccccatc tctgaccatg aggtcaccct gaggtgctgg gccctgggct      1620
     tctaccctgc ggagatcaca ctgacctggc agcgggatgg cgaggaccaa actcaggaca      1680
     ccgagcttgt ggagaccaga ccagcaggag atagaacctt ccagaagtgg gcagctgtgg      1740
     tggtgccttc tggagaagag cagagataca catgccatgt acagcatgag gggctgccga      1800
     agcccctcac cctgagatgg ggtaaggagg gggatgaggg gtcatatctc ttctcaggga      1860
     aagcaggagc ccttcagcag ggtcagggcc cctcatcttc ccttcctttc ccagagccgt      1920
     cttcccagtc caccgtcccc atcgtgggca ttgttgctgg cctggctgtc a               1971
//


spacer
spacer