Dbfetch

ID   FJ227106; SV 1; linear; genomic DNA; STD; HUM; 1022 BP.
XX
AC   FJ227106;
XX
DT   15-OCT-2008 (Rel. 97, Created)
DT   12-DEC-2012 (Rel. 115, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*25new allele, exons 2
DE   through 4 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1022
RX   DOI; 10.1016/j.humimm.2009.06.011.
RX   PUBMED; 19539002.
RA   Cordovado S.K., Hancock L.N., Hendrix M., Greene C.N., Mueller P.W.;
RT   "Novel human leukocyte antigen class I and class II alleles identified by
RT   sequence-based typing in the Genetics of Kidneys in Diabetes (GoKinD) study
RT   population";
RL   Hum. Immunol. 70(9):747-749(2009).
XX
RN   [2]
RP   1-1022
RA   Hancock L.N., Cordovado S.K., Mueller P.W.;
RT   ;
RL   Submitted (19-SEP-2008) to the INSDC.
RL   NCEH/DLS/NSMBB/MRAL, Centers for Disease Control and Prevention, 4770
RL   Buford Highway MS F-24, Atlanta, GA 30341, USA
XX
DR   MD5; 0ef3e048963e4553d493a728895eaa96.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1022
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1022
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*25new"
FT   mRNA            join(<1..270,371..646,747..>1022)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*25new"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,371..646,747..>1022)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*25new"
FT                   /product="MHC class I antigen"
FT                   /note="antigen presenting molecule"
FT                   /db_xref="GOA:B6ECH4"
FT                   /db_xref="IMGT/HLA:A*25:07"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:B6ECH4"
FT                   /protein_id="ACI43210.1"
FT                   /translation="SHSMRYFYTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDRNTRNVKAHSQTDRESLRIALRYYNQSEDGSHTIQRMYGCDVGP
FT                   DGRFLRGYQQDAYDGKDYIALNEDLRSWTAADMAAQITQRKWETAHEAEQWRAYLEGRC
FT                   VEWLRRYLENGKETLQRTDAPKTHMTHHGVSDHEATLRCWALSFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDGTFQKWASVVVPSGQEQRYTCHVQHEGLPKPLTLRW"
FT   exon            1..270
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*25new"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..646
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*25new"
FT                   /number=3
FT   gap             647..746
FT                   /estimated_length=unknown
FT   exon            747..1022
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*25new"
FT                   /number=4
XX
SQ   Sequence 1022 BP; 167 A; 248 C; 287 G; 120 T; 200 other;
     gctcccactc catgaggtat ttctacacct ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accggaacac acggaatgtg aaggcccact cacagactga ccgagagagc ctgcggatcg       240
     cgctccgcta ctacaaccag agcgaggacg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn gttctcacac catccagagg atgtatggct gcgacgtggg gccggacggg       420
     cgcttcctcc gcgggtacca gcaggacgct tacgacggca aggattacat cgccctgaac       480
     gaggacctgc gctcttggac cgcggcggac atggcggctc agatcaccca gcgcaagtgg       540
     gagacggccc atgaggcgga gcagtggaga gcctacctgg agggccggtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gcacggnnnn nnnnnnnnnn       660
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       720
     nnnnnnnnnn nnnnnnnnnn nnnnnnacgc ccccaagacg catatgactc accacggtgt       780
     ctctgaccat gaggccaccc tgaggtgctg ggccctgagc ttctaccctg cggagatcac       840
     actgacctgg cagcgggatg gggaggacca gacccaggac acggagctcg tggagaccag       900
     gcctgcaggg gatgggacct tccagaagtg ggcgtctgtg gtggtgcctt ctggacagga       960
     gcagagatac acctgccatg tgcagcatga gggtctgccc aagcccctca ccctgagatg      1020
     gg                                                                     1022
//