spacer

EBI Dbfetch

ID   FJ227104; SV 1; linear; genomic DNA; STD; HUM; 1078 BP.
XX
AC   FJ227104;
XX
DT   15-OCT-2008 (Rel. 97, Created)
DT   12-DEC-2012 (Rel. 115, Last updated, Version 2)
XX
DE   Homo sapiens isolate D183D MHC class I antigen (HLA-A) gene, HLA-A*03new
DE   allele, exons 2s, 3s, 4s and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1078
RX   DOI; 10.1016/j.humimm.2009.06.011.
RX   PUBMED; 19539002.
RA   Cordovado S.K., Hancock L.N., Hendrix M., Greene C.N., Mueller P.W.;
RT   "Novel human leukocyte antigen class I and class II alleles identified by
RT   sequence-based typing in the Genetics of Kidneys in Diabetes (GoKinD) study
RT   population";
RL   Hum. Immunol. 70(9):747-749(2009).
XX
RN   [2]
RP   1-1078
RA   Hancock L.N., Cordovado S.K., Mueller P.W.;
RT   ;
RL   Submitted (19-SEP-2008) to the INSDC.
RL   NCEH/DLS/NSMBB/MRAL, Centers for Disease Control and Prevention, 4770
RL   Buford Highway MS F-24, Atlanta, GA 30341, USA
XX
DR   MD5; d469409b1906dff8619382d5fa424819.
DR   Ensembl-Gn; ENSG00000206503; homo_sapiens.
DR   Ensembl-Tr; ENST00000376802; homo_sapiens.
DR   Ensembl-Tr; ENST00000376806; homo_sapiens.
DR   Ensembl-Tr; ENST00000376809; homo_sapiens.
DR   Ensembl-Tr; ENST00000396634; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1078
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /isolate="D183D"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1022
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*03new"
FT   mRNA            join(<1..270,371..646,747..>1022)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*03new"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,371..646,747..>1022)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*03new"
FT                   /product="MHC class I antigen"
FT                   /note="antigen presenting molecule"
FT                   /db_xref="GOA:B6ECH2"
FT                   /db_xref="IMGT/HLA:A*03:01:07"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:B6ECH2"
FT                   /protein_id="ACI43208.1"
FT                   /translation="SHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQSEAGSHTIQIMYGCDVGS
FT                   DGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAAHEAEQLRAYLDGTC
FT                   VEWLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW"
FT   exon            1..270
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*03new"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..646
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*03new"
FT                   /number=3
FT   gap             647..746
FT                   /estimated_length=unknown
FT   exon            747..1022
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*03new"
FT                   /number=4
XX
SQ   Sequence 1078 BP; 181 A; 256 C; 307 G; 134 T; 200 other;
     gctcccactc catgaggtat ttcttcacat ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accaggagac acggaatgtg aaggcccagt cacagactga ccgagtggac ctggggaccc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn gttctcacac catccagata atgtatggct gcgacgtggg gtcggacggg       420
     cgcttcctcc gcgggtaccg gcaggacgcc tacgacggca aggattacat cgccctgaac       480
     gaggacctgc gctcttggac cgcggcggac atggcggctc agatcaccaa gcgcaagtgg       540
     gaggcggccc atgaggcgga gcagttgaga gcctacctgg atggcacgtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gcacggnnnn nnnnnnnnnn       660
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       720
     nnnnnnnnnn nnnnnnnnnn nnnnnnatcc ccccaagaca catatgaccc accaccccat       780
     ctctgaccat gaggccaccc tgaggtgctg ggccctgggc ttctaccctg cggagatcac       840
     actgacctgg cagcgggatg gggaggacca gacccaggac acggagctcg tggagaccag       900
     gcctgcaggg gatggaacct tccagaagtg ggcggctgtg gtggtgcctt ctggagagga       960
     gcagagatac acctgccatg tgcagcatga gggtctgccc aagcccctca ccctgagatg      1020
     gggtaaggag ggagatgggg gtgtcatgtc tcttagggaa agcaggagcc tctctgac        1078
//


spacer
spacer