spacer

EBI Dbfetch

ID   FJ200656; SV 1; linear; genomic DNA; STD; HUM; 786 BP.
XX
AC   FJ200656;
XX
DT   14-OCT-2008 (Rel. 97, Created)
DT   14-OCT-2008 (Rel. 97, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*51 new allele, partial
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-786
RA   Yan L.N., An S.P., Li S.Y., Xie J.H., Dong L., Dong Z., Yuan Y.H.;
RT   "A new HLA-B*51 allele detected with SBT";
RL   Unpublished.
XX
RN   [2]
RP   1-786
RA   Yan L.N., An S.P., Li S.Y., Xie J.H., Dong L., Dong Z., Yuan Y.H.;
RT   ;
RL   Submitted (12-SEP-2008) to the INSDC.
RL   Tissue Typing Lab, Tianjin Blood Center, No. 424, Huanghe Road, Tianjin
RL   300110, China
XX
DR   MD5; 7f36ae26b451ac0bece8b2b29def6e3f.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..786
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /note="PCR_primers=fwd_name: HLA-B-E3F, rev_name:
FT                   HLA-B-E2R"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>786
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*51 new"
FT   mRNA            join(<1..270,511..>786)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*51 new"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,511..>786)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*51 new"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:B6E323"
FT                   /db_xref="IMGT/HLA:B*51:63"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:B6E323"
FT                   /protein_id="ACI26703.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTE
FT                   PRAPWIEQEGPEYWDRNTQIFKTNTQTYRENLRIALRYYNQSEAGSHTWQTMYGCDVGP
FT                   DGRLLRGHNQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAAREAEQLRAYLEGLC
FT                   VEWLRRHLENGKETLQRA"
FT   gap             271..510
FT                   /estimated_length=240
FT   variation       586
FT                   /gene="HLA-B"
FT                   /replace="a"
FT                   /note="compared with HLA-B*510101"
XX
SQ   Sequence 786 BP; 114 A; 173 C; 186 G; 73 T; 240 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcattgc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag gacggagccc cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accggaacac acagatcttc aagaccaaca cacagactta ccgagagaac ctgcggatcg       240
     cgctccgcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn ggtctcacac ttggcagacg atgtatggct       540
     gcgacgtggg gccggacggg cgcctcctcc gcgggcataa ccagtccgcc tacgacggca       600
     aagattacat cgccctgaac gaggacctga gctcctggac cgcggcggac accgcggctc       660
     agatcaccca gcgcaagtgg gaggcggccc gtgaggcgga gcagctgaga gcctacctgg       720
     agggcctgtg cgtggagtgg ctccgcagac acctggagaa cgggaaggag acgctgcagc       780
     gcgcgg                                                                  786
//


spacer
spacer