spacer

EBI Dbfetch

ID   FJ200654; SV 1; linear; genomic DNA; STD; HUM; 786 BP.
XX
AC   FJ200654;
XX
DT   14-OCT-2008 (Rel. 97, Created)
DT   07-APR-2013 (Rel. 116, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*33 new variant allele,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-786
RX   PUBMED; 22803599.
RA   Xie J.H., Yan L.N., Li S.Y., An S.P., Yuan Y.H.;
RT   "Identification of the novel allele HLA-A*33:22 by sequence-based typing in
RT   a Chinese individual";
RL   Tissue Antigens 80(4):381-383(2012).
XX
RN   [2]
RP   1-786
RA   Yan L.N., An S.P., Li S.Y., Xie J.H., Dong Z., Dong L., Yuan Y.H.;
RT   "A new allele of HLA-A*33 detected with SBT";
RL   Unpublished.
XX
RN   [3]
RP   1-786
RA   Yan L.N., An S.P., Li S.Y., Xie J.H., Dong Z., Dong L., Yuan Y.H.;
RT   ;
RL   Submitted (11-SEP-2008) to the INSDC.
RL   Tissue Typing Lab, Tianjin Blood Center, No. 424, Huanghe Road, Tianjin
RL   300110, China
XX
DR   MD5; f93fabb16237ad5324134e82e93055b1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..786
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /note="PCR_primers=fwd_name: HLA-A E2F;
FT                   PCR_primers=fwd_name: HLA-A-E3F"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>786
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*33 new variant"
FT   mRNA            join(<1..270,511..>786)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*33 new variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,511..>786)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*33 new variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:B6E322"
FT                   /db_xref="IMGT/HLA:A*33:22"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:B6E322"
FT                   /protein_id="ACI26702.1"
FT                   /translation="SHSMRYFTTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDRNTRNVKAHSQIDRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGS
FT                   DGRFLRGYQQDAYDGKDYIALNEDLRSWTAADMAAQITQRKWEAARVAEQLRAYLEGTC
FT                   VEWLRRYLENGKETLQRT"
FT   gap             271..510
FT                   /estimated_length=240
FT   variation       522
FT                   /gene="HLA-A"
FT                   /replace="a"
FT                   /note="compared with HLA-A*330301"
FT   variation       529
FT                   /gene="HLA-A"
FT                   /replace="t"
FT                   /note="compared with HLA-A*330301"
XX
SQ   Sequence 786 BP; 106 A; 163 C; 199 G; 78 T; 240 other;
     gctcccactc catgaggtat ttcaccacat ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accggaacac acggaatgtg aaggcccact cacagattga ccgagtggac ctggggaccc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn gttctcacac cgtccagagg atgtatggct       540
     gcgacgtggg gtcggacggg cgcttcctcc gcgggtacca gcaggacgcc tacgacggca       600
     aggattacat cgccttgaac gaggacctgc gctcttggac cgcggcggac atggcggctc       660
     agatcaccca gcgcaagtgg gaggcggccc gtgtggcgga gcagttgaga gcctacctgg       720
     agggcacgtg cgtggagtgg ctccgcagat acctggagaa cgggaaggag acgctgcagc       780
     gcacgg                                                                  786
//


spacer
spacer