spacer

EBI Dbfetch

ID   FJ196839; SV 1; linear; genomic DNA; STD; HUM; 1944 BP.
XX
AC   FJ196839;
XX
DT   02-OCT-2008 (Rel. 97, Created)
DT   07-JAN-2009 (Rel. 98, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*680802 allele, exons 1
DE   through 5 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1944
RA   Rife A.L., Eller S.R., Iglehart B.S., Leffell M.S.;
RT   "Identification of a Novel Allele: HLA-A*680802";
RL   Unpublished.
XX
RN   [2]
RP   1-1944
RA   Rife A.L., Eller S.R., Iglehart B.S., Leffell M.S.;
RT   ;
RL   Submitted (09-SEP-2008) to the INSDC.
RL   Medicine, Johns Hopkins University, 2041 E. Monument St., Baltimore, MD
RL   21205, USA
XX
DR   MD5; b2fc181461b8b21a00b3c340a9774bde.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1944
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1944
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*680802"
FT   mRNA            join(<1..20,151..420,662..937,1538..1813,1913..>1944)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*680802"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..20,151..420,662..937,1538..1813,1913..>1944)
FT                   /codon_start=2
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*680802"
FT                   /product="MHC class I antigen"
FT                   /note="major histocompatibility complex; leukocyte antigen"
FT                   /db_xref="GOA:B6E278"
FT                   /db_xref="IMGT/HLA:A*68:08:02"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:B6E278"
FT                   /protein_id="ACI22667.1"
FT                   /translation="LTQTWAGSHSMRYFYTSVSRPGRGEPRFIAVGYVDDTQFVRFDSD
FT                   AASQRMEPRAPWIEQEGPEYWDRNTRNVKAQSQTDRVDLGTLRGYYNQSEAGSHTIQMM
FT                   YGCDVGSDGRFLRGYRQDAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQLR
FT                   AYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLT
FT                   WQRDGEDQTQDTELVETRPAGDGTFQKWVAVVVPSGQEQRYTCHVQHEGLPKPLTLRWE
FT                   PSSQPTIPIV"
FT   exon            <1..20
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*680802"
FT                   /number=1
FT   exon            151..420
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*680802"
FT                   /number=2
FT   exon            662..937
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*680802"
FT                   /number=3
FT   exon            1538..1813
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*680802"
FT                   /number=4
FT   exon            1913..>1944
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*680802"
FT                   /number=5
XX
SQ   Sequence 1944 BP; 372 A; 596 C; 629 G; 347 T; 0 other;
     cctgacccag acctgggcgg gtgagtgcgg ggtcgggagg gaaacggcct ctgtggggag        60
     aagcaagggg cccgcccggc gggggcgcag gacccgggaa gccgcgcctg gaggagggtc       120
     gggcgggtct cagccactcc tcgcccccag gctcccactc catgaggtat ttctacactt       180
     ccgtgtcccg gcccggccgc ggggagcccc gcttcatcgc cgtgggctac gtggacgaca       240
     cgcagttcgt gcggttcgac agcgacgccg cgagccagag gatggagccg cgggcgccgt       300
     ggatagagca ggaggggccg gagtattggg accggaacac acggaatgtg aaggcccagt       360
     cacagactga ccgagtggac ctggggaccc tgcgcggcta ctacaaccag agcgaggccg       420
     gtgagtgacc ccggcccggg gcgcaggtca cgacccctca tcccccacgg acgggccagg       480
     tcgcccacag tctccgggtc cgagatccgc cccgaagccg cgggaccccg agacccttgc       540
     cccgggagag gcccaggcgc ctttacccgg tttcattttc agtttaggcc aaaaatcccc       600
     ccgggttggt cggggcgggg cggggctcgg gggaccgggc tgacctcggg gtccgggcca       660
     ggttctcaca ccatccagat gatgtatggc tgcgacgtgg ggtcggacgg gcgcttcctc       720
     cgcgggtacc ggcaggacgc ctacgacggc aaggattaca tcgccctgaa agaggacctg       780
     cgctcttgga ccgcggcgga catggcagct cagaccacca agcacaagtg ggaggcggcc       840
     catgtggcgg agcagttgag agcctacctg gagggcacgt gcgtggagtg gctccgcaga       900
     tacctggaga acgggaagga gacgctgcag cgcacgggta ccaggggcca cggggcgcct       960
     ccctgatcgc ctgtagatct cccgggctgg cctcccacaa ggaggggaga caattgggac      1020
     caacactaga atatcgccct ccctctggtc ctgagggaga ggaatcctcc tgggtttcca      1080
     gatcctgtac cagagagtga ctctgaggtt ccgccctgct ctctgacaca attaagggat      1140
     aaaatctctg aaggaatgac gggaagacga tccctcgaat actgatgagt ggttcccttt      1200
     gacacacaca ggcagcagcc ttgggcccgt gacttttcct ctcaggcctt gttctctgct      1260
     tcacactcaa tgtgtgtggg ggtctgagtc cagcacttct gagtccctca gcctccactc      1320
     aggtcaggac cagaagtcgc tgttccctct tcagggacta gaattttcca cggaatagga      1380
     gattatccca ggtgcctgtg tccaggctgg tgtctgggtt ctgtgctccc ttccccatcc      1440
     caggtgtcct gtccattctc aagatagcca catgtgtgct ggaggagtgt cccatgacag      1500
     atgcaaaatg cctgaatgat ctgactcttc ctgacagacg cccccaaaac gcatatgact      1560
     caccacgctg tctctgacca tgaagccacc ctgaggtgct gggccctgag cttctaccct      1620
     gcggagatca cactgacctg gcagcgggat ggggaggacc agacccagga cacggagctc      1680
     gtggagacca ggcctgcagg ggatggaacc ttccagaagt gggtggctgt ggtggtgcct      1740
     tctggacagg agcagagata cacctgccat gtgcagcatg agggtttgcc caagcccctc      1800
     accctgagat ggggtaagga gggagacggg ggtgtcatgt cttttaggga aagcaggagc      1860
     ctctctgacc tttagcaggg tcagggcccc tcaccttccc ctcttttccc agagccgtct      1920
     tcccagccca ccatccccat cgtg                                             1944
//


spacer
spacer