spacer

EBI Dbfetch

ID   FJ174674; SV 1; linear; genomic DNA; STD; HUM; 899 BP.
XX
AC   FJ174674;
XX
DT   02-OCT-2008 (Rel. 97, Created)
DT   02-OCT-2008 (Rel. 97, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*57 variant allele,
DE   exons 2, 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-899
RA   Chen W.-H., Shen J., Chang C.-F.;
RT   "A novel HLA-B*57 allele";
RL   Unpublished.
XX
RN   [2]
RP   1-899
RA   Chen W.-H., Shen J., Chang C.-F.;
RT   ;
RL   Submitted (01-SEP-2008) to the INSDC.
RL   Sinica, IBMS, 128 Sec. 2, Academia Rd. Nankang, Taipei 115, Taiwan
XX
DR   MD5; ac953673c3f06ab19bac93350e6f1058.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..899
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /note="PCR_primers=fwd_name: Bin1-CG-M13F, rev_name:
FT                   Bin3-M13R; PCR_primers=fwd_name: Bin1-TA-M13F"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>899
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*57 variant"
FT   mRNA            join(<61..330,577..>852)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*57 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(<61..330,577..>852)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*57 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:B6DX34"
FT                   /db_xref="IMGT/HLA:B*57:18"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:B6DX34"
FT                   /protein_id="ACI22357.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMA
FT                   PRAPWIEQEGPEYWDGETRNMKASAQTYRENLRIALRYYNQSEAGSHIIQVMYGCDVGP
FT                   DGRLLRGHDQSAYDGKDYIALNEDLSSWTAAYTAAQITQRKWEAARVAEQLRAYLEGLC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            61..330
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*57 variant"
FT                   /number=2
FT   exon            577..852
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*57 variant"
FT                   /number=3
FT   variation       714
FT                   /gene="HLA-B"
FT                   /replace="g"
FT                   /note="Y137D; compared to HLAB*570101"
XX
SQ   Sequence 899 BP; 150 A; 301 C; 327 G; 121 T; 0 other;
     gacccgggga gccgcgccgg gaggagggtc gggcgggtct cagcccctcc tcgcccccag        60
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc       120
     gcttcatcgc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       180
     cgagtccgag gatggcgccc cgggcgccat ggatagagca ggaggggccg gagtattggg       240
     acggggagac acggaacatg aaggcctccg cgcagactta ccgagagaac ctgcggatcg       300
     cgctccgcta ctacaaccag agcgaggccg gtgagtgacc ccggcccggg gcgcaggtca       360
     cgactcccca tcccccacgt acggcccggg tcgccccgag tctccgggtc cgagatccac       420
     ccccctgagg ccgcgggacc cgcccagacc ctcgaccggc gagagcccca ggcgcgttta       480
     cccggtttca ttttcagttg aggccaaaat ccccgcgggt tggtcagggc ggggcggggc       540
     tcggggggac ggggctgacc gcggggccgg ggccagggtc tcacatcatc caggtgatgt       600
     atggctgcga cgtggggccg gacgggcgcc tcctccgcgg gcatgaccag tccgcctacg       660
     acggcaagga ttacatcgcc ctgaacgagg acctgagctc ctggaccgcg gcgtacacgg       720
     cggctcagat cacccagcgc aagtgggagg cggcccgtgt ggcggagcag ctgagagcct       780
     acctggaggg cctgtgcgtg gagtggctcc gcagatacct ggagaacggg aaggagacgc       840
     tgcagcgcgc gggtaccagg ggcagtgggg agccttcccc atctcctata ggtcgccgg        899
//


spacer
spacer