Dbfetch

ID   FJ167397; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   FJ167397;
XX
DT   30-SEP-2008 (Rel. 97, Created)
DT   30-AUG-2009 (Rel. 102, Last updated, Version 2)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*09 variant
DE   allele, exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RX   DOI; 10.1111/j.1399-0039.2009.01293.x.
RX   PUBMED; 19563526.
RA   Kim Y.H., Kang Y.M., Lee G.E., Cho Y.S.;
RT   "HLA-DRB1*0908, a new allele was identified by sequence-based typing in a
RT   Korean individual";
RL   Tissue Antigens 74(3):264-265(2009).
XX
RN   [2]
RP   1-270
RA   Kim Y.;
RT   ;
RL   Submitted (28-AUG-2008) to the INSDC.
RL   Special Molecular Biology Section, Samkwang Medical Lab., 9-60,
RL   Yangjae-Dong, Seocho-Gu, Seoul 137-887, Republic of Korea
XX
DR   MD5; b93999f44d93e549b10df334edb3ad61.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*09 variant"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*09 variant"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*09 variant"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:B6DST2"
FT                   /db_xref="IMGT/HLA:DRB1*09:08"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:B6DST2"
FT                   /protein_id="ACI16357.1"
FT                   /translation="RFLKQDKFECHFFNGTERVRYLHRGIYNQEENVRFDSDVGEYRAV
FT                   TELGRPSAESWNSQKDFLERRRAEVDTVCRHNYGVGESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*09 variant"
FT                   /number=2
XX
SQ   Sequence 270 BP; 61 A; 61 C; 102 G; 46 T; 0 other;
     cacgtttctt gaagcaggat aagtttgagt gtcatttctt caacgggacg gagcgggtgc        60
     ggtatctgca cagaggcatc tataaccaag aggagaacgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctagcgc cgagtcctgg aacagccaga       180
     aggacttcct ggagcggagg cgggccgagg tggacaccgt gtgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagaggcgag                                        270
//