spacer

EBI Dbfetch

ID   FJ167389; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   FJ167389;
XX
DT   28-SEP-2008 (Rel. 97, Created)
DT   19-NOV-2010 (Rel. 106, Last updated, Version 2)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB) gene, exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RX   DOI; 10.1111/j.1399-0039.2010.01536.x.
RX   PUBMED; 20630035.
RA   Liu J., Liu N., Shan X., Li W., Zhang Z.;
RT   "A novel HLA-DRB1 allele, DRB1*08:36, identified by sequence-based typing";
RL   Tissue Antigens 76(5):426-427(2010).
XX
RN   [2]
RP   1-270
RA   Wang L., Shan X., Ni L., Cui S., Liu N., Li W., He X., Wang L., Zhao B.,
RA   Gong Z., Zhang Z.;
RT   "Identification of a novel allele by SBT";
RL   Unpublished.
XX
RN   [3]
RP   1-270
RA   Wang L., Shan X., Ni L., Cui S., Liu N., Li W., He X., Wang L., Zhao B.,
RA   Gong Z., Zhang Z.;
RT   ;
RL   Submitted (28-AUG-2008) to the INSDC.
RL   HLA Lab, Beijing Red Cross Blood Center, 37 North Third Ring Road, Beijing
RL   100088, China
XX
DR   MD5; 90cdd945db0e4f3142e9dbedccd19458.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DRB"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:B6DST0"
FT                   /db_xref="IMGT/HLA:DRB1*08:36:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:B6DST0"
FT                   /protein_id="ACI05266.1"
FT                   /translation="RFLEYSTGECYFFNGTERVRFLDRYFHNQEEYVRFDSDVGEYRAV
FT                   TELGRPSAEYWNSQKDILEDRRALVDTYCRHNYGVGESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB"
FT                   /number=2
FT   variation       81
FT                   /gene="HLA-DRB"
FT                   /replace="t"
FT                   /note="compared with HLA-DRB1*08032; H32Y"
XX
SQ   Sequence 270 BP; 59 A; 64 C; 97 G; 50 T; 0 other;
     cacgtttctt ggagtactct acgggtgagt gttatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc cataaccaag aggagtacgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctagcgc cgagtactgg aacagccaga       180
     aggacatcct ggaagacagg cgggccctgg tggacaccta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer