spacer

EBI Dbfetch

ID   FJ041909; SV 1; linear; genomic DNA; STD; HUM; 792 BP.
XX
AC   FJ041909;
XX
DT   24-SEP-2008 (Rel. 97, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-Cw) gene, HLA-Cw*var allele, exons 2,
DE   3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-792
RA   Vigh A., Fuerst D., Mytilineos J.;
RT   "Characterization of a new HLA-Cw*05 allele";
RL   Unpublished.
XX
RN   [2]
RP   1-792
RA   Vigh A., Fuerst D., Mytilineos J.;
RT   ;
RL   Submitted (19-AUG-2008) to the INSDC.
RL   Transplantation Immunology, Institute for Clinical Transfusion Medicine and
RL   Immunogenetics, Helmholtzstr. 10, Ulm 89081, Germany
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..792
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>792
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*var"
FT   mRNA            join(<1..270,517..>792)
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*var"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,517..>792)
FT                   /codon_start=3
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*var"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:B5TYU2"
FT                   /db_xref="IMGT/HLA:C*05:21"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:B5TYU2"
FT                   /protein_id="ACI02329.1"
FT                   /translation="SHSMRYFYTAVSRPGRGEPRFIAVGYVDDTQFVQFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQKYKRQAQTDRVNLRKLRGHYNQSEAGSHTLQRMYGCDLGP
FT                   DGRLLRGYNQFAYDGKDYIALNEDLRSWTAADKAAQITQRKWEAAREAEQRRAYLEGTC
FT                   VEWLRRYLENGKKTLQRA"
FT   exon            1..270
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*var"
FT                   /number=2
FT   variation       249
FT                   /gene="HLA-Cw"
FT                   /replace="t"
FT                   /note="results in tyrosine to histidine substitution;
FT                   compared with HLA-Cw*050101"
FT   exon            517..792
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*var"
FT                   /number=3
XX
SQ   Sequence 792 BP; 147 A; 260 C; 282 G; 103 T; 0 other;
     gctcccactc catgaggtat ttctacaccg ccgtgtcccg gcccggccgc ggagagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cgcagttcgt gcagttcgac agcgacgccg       120
     cgagtccaag aggggagccg cgggcgccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaagtac aagcgccagg cacagactga ccgagtgaac ctgcggaaac       240
     tgcgcggcca ctacaaccag agcgaggccg gtgagtgacc ccggcccggg gcgcaggtca       300
     cgacccctcc ccatccccca cggacggccc gggtcgcccc gagtctcccg gtctgagatc       360
     caccccgagg ctgcggaacc cgcccagacc ctcgaccgga gagagcccca gtcaccttta       420
     cccggtttca ttttcagttt aggccaaaat ccccgcgggt tggtcggggc tggggcgggg       480
     ctcgggggac ggggctgacc acgggggcgg ggccagggtc tcacaccctc cagaggatgt       540
     atggctgcga cctggggccc gacgggcgcc tcctccgcgg gtataaccag ttcgcctacg       600
     acggcaagga ttacatcgcc ctgaatgagg acctgcgctc ctggaccgcc gcggacaagg       660
     cggctcagat cacccagcgc aagtgggagg cggcccgtga ggcggagcag cggagagcct       720
     acctggaggg cacgtgcgtg gagtggctcc gcagatacct ggagaacggg aagaagacgc       780
     tgcagcgcgc gg                                                           792
//


spacer
spacer