spacer

EBI Dbfetch

ID   FJ009630; SV 1; linear; genomic DNA; STD; HUM; 792 BP.
XX
AC   FJ009630;
XX
DT   17-SEP-2008 (Rel. 97, Created)
DT   17-SEP-2008 (Rel. 97, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-Cw) gene, HLA-Cw*0704 allele, exons
DE   2, 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-792
RA   Cao K., Wang Q., Muramoto J., Semendyayeva M., Naim M., Ong G.,
RA   Reinsmoen N.L.;
RT   "New Variant of HLA-Cw*070401";
RL   Unpublished.
XX
RN   [2]
RP   1-792
RA   Cao K., Wang Q., Muramoto J., Semendyayeva M., Naim M., Ong G.,
RA   Reinsmoen N.L.;
RT   ;
RL   Submitted (12-AUG-2008) to the INSDC.
RL   HLA Laboratory, Comprehensive Transplant Center, Cedars-Sinai Health
RL   System, 8723 Alden Drive, SSB-197, Los Angeles, CA 90048, USA
XX
DR   MD5; 24903748edc23627fef367b15fecabed.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..792
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>792
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*0704"
FT   mRNA            join(<1..270,517..>792)
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*0704"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,517..>792)
FT                   /codon_start=3
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*0704"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:B5TRS5"
FT                   /db_xref="IMGT/HLA:C*07:63"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:B5TRS5"
FT                   /protein_id="ACH86118.1"
FT                   /translation="SHSMRYFDTAVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQKYKRQAQADRVSLRNLRGYYNQSEDGSHTFQRMYGCDLGP
FT                   YGRLLRGYDQFAYDGKDYIALNEDLRSWTAADTAAQITQRKLEAARAAEQDRAYLEGTC
FT                   VEWLRRYLENGKKTLQRA"
FT   exon            1..270
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*0704"
FT                   /number=2
FT   gap             271..516
FT                   /estimated_length=246
FT   exon            517..792
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*0704"
FT                   /number=3
XX
SQ   Sequence 792 BP; 106 A; 172 C; 196 G; 72 T; 246 other;
     gctcccactc catgaggtat ttcgacaccg ccgtgtcccg gcccggccgc ggagagcccc        60
     gcttcatctc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccgag aggggagccc cgggcgccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaagtac aagcgccagg cacaggctga ccgagtgagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggacg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnggtc tcacaccttc cagaggatgt       540
     atggctgcga cctggggccc tacgggcgcc tcctccgcgg gtatgaccag ttcgcctacg       600
     acggcaagga ttacatcgcc ctgaacgagg acctgcgctc ctggaccgcc gcggacaccg       660
     cggctcagat cacccagcgc aagttggagg cggcccgtgc ggcggagcag gacagagcct       720
     acctggaggg cacgtgcgtg gagtggctcc gcagatacct ggagaacggg aagaagacgc       780
     tgcagcgcgc gg                                                           792
//


spacer
spacer