spacer

EBI Dbfetch

ID   EU981815; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   EU981815;
XX
DT   04-SEP-2008 (Rel. 97, Created)
DT   04-SEP-2008 (Rel. 97, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*3901 variant allele,
DE   exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Jie L.;
RT   "Analysis and Sequence of HLA-B New Site";
RL   Unpublished.
XX
RN   [2]
RP   1-270
RA   Jie L., Ling H., Xin L., Yong L., Juan D.;
RT   ;
RL   Submitted (01-AUG-2008) to the INSDC.
RL   Institude of Blood Transfusion, HeiLongjiang Blood Center, No.28 WeiXing
RL   Road, HarBin, HeiLongjiang 150056, People's Republic of China
XX
DR   MD5; dabef09367ca654295bf59cc51c6a875.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*3901 variant"
FT   mRNA            <1..>270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*3901 variant"
FT                   /product="MHC class I antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*3901 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:B5M6P3"
FT                   /db_xref="IMGT/HLA:B*39:01:06"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:B5M6P3"
FT                   /protein_id="ACH70298.1"
FT                   /translation="SHSMRYFYTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREE
FT                   PRAPWIEQEGPEYWDRNTQICKTNTQTDRESLRNLRGYYNQSEA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*3901 variant"
FT                   /number=2
XX
SQ   Sequence 270 BP; 59 A; 85 C; 90 G; 36 T; 0 other;
     gctcccactc catgaggtat ttctacacct ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatctc agtgggctac gtggacgaca cgcagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag ggaggagccg cgggcgccgt ggatagagca ggaggggccg gaatattggg       180
     accggaacac acagatctgc aagaccaaca cacagactga ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg                                        270
//


spacer
spacer