Dbfetch

ID   EU980095; SV 1; linear; genomic DNA; STD; HUM; 962 BP.
XX
AC   EU980095;
XX
DT   09-SEP-2008 (Rel. 97, Created)
DT   09-SEP-2008 (Rel. 97, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*3320 allele, exons 2,
DE   3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-962
RA   Chang Y., Pascual C.J., Alonzo P.;
RT   "Identification of a new HLA-A*33 variant";
RL   Unpublished.
XX
RN   [2]
RP   1-962
RA   Chang Y., Pascual C.J., Alonzo P.;
RT   ;
RL   Submitted (04-AUG-2008) to the INSDC.
RL   Pathology, All Children's Hospital, 801 6th Street South, St. Petersburg,
RL   FL 33701, USA
XX
DR   MD5; dba6888f9f2607df2f41951666fdb585.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..962
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>962
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*3320"
FT   mRNA            join(<130..399,641..>916)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*3320"
FT                   /product="MHC class I antigen"
FT   CDS             join(<130..399,641..>916)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*3320"
FT                   /product="MHC class I antigen"
FT                   /db_xref="IMGT/HLA:A*33:20"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:B5TJZ7"
FT                   /protein_id="ACH73187.1"
FT                   /translation="SHSMRYFTTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDRNTRNVKAHSQIDRVDLGTLRGYYNQSEAGSHTIQMMYGCDVGS
FT                   DGRFLRGYQQDAYDGKDYIALNEDLRSWTPADMAAQITQRKWEAARVAEQLRAYLEGTC
FT                   VEWLRRYLENGKETLQRT"
FT   exon            130..399
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*3320"
FT                   /number=2
FT   exon            641..916
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*3320"
FT                   /number=3
XX
SQ   Sequence 962 BP; 168 A; 309 C; 351 G; 134 T; 0 other;
     gtgagtgcgg ggtcgtgggg aaaccgcctc tgcggggaga agcaaggggc ccgcccggcg        60
     ggggcgcagg acccgggtag ccgcgccggg aggagggtcg ggcggatctc agccactcct       120
     cgcccccagg ctcccactcc atgaggtatt tcaccacatc cgtgtcccgg cccggccgcg       180
     gggagccccg cttcatcgcc gtgggctacg tggacgacac gcagttcgtg cggttcgaca       240
     gcgacgccgc gagccagagg atggagccgc gggcgccgtg gatagagcag gaggggccgg       300
     agtattggga ccggaacaca cggaatgtga aggcccactc acagattgac cgagtggacc       360
     tggggaccct gcgcggctac tacaaccaga gcgaggccgg tgagtgaccc cagcccgggg       420
     cgcaggtcac gacctctcat cccccacgga cgggccaggt cacccacagt ctccgggtcc       480
     gagatccacc ccgaagccgc gggaccccga gacccttgcc ccgggagagg cccaggcgcc       540
     tttacccggt ttcattttca gtttaggcca aaaatccccc cgggttggtc ggggccggac       600
     ggggctcggg ggactgggct gaccgtgggg tcggggccag gttctcacac catccagatg       660
     atgtatggct gcgacgtggg gtcggacggg cgcttcctcc gcgggtacca gcaggacgcc       720
     tacgacggca aggattacat cgccttgaac gaggacctgc gctcttggac cccggcggac       780
     atggcggctc agatcaccca gcgcaagtgg gaggcggccc gtgtggcgga gcagttgaga       840
     gcctacctgg agggcacgtg cgtggagtgg ctccgcagat acctggagaa cgggaaggag       900
     acgctgcagc gcacgggtac caggggccac ggggcgcctc cctgatcgcc tgtagatctc       960
     cc                                                                      962
//