Dbfetch

ID   EU939322; SV 1; linear; genomic DNA; STD; HUM; 276 BP.
XX
AC   EU939322;
XX
DT   19-AUG-2008 (Rel. 96, Created)
DT   07-APR-2013 (Rel. 116, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*5401N allele, exon 3
DE   and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-276
RX   PUBMED; 23216291.
RA   Gong Z., Zhang Z.X., Shan X., Li D., Li W.;
RT   "A novel HLA-B*54 allele, B*54:16";
RL   Tissue Antigens 81(1):57-58(2013).
XX
RN   [2]
RP   1-276
RA   Wang L., Wang L., Cui S., He X., Ni L., Liu N., Li W., Zhao B., Gong Z.,
RA   Zhang Z., Shan X.;
RT   "Identification of a Novel HLA-B*5401 Allele in Chinese Stem Cell Donors";
RL   Unpublished.
XX
RN   [3]
RP   1-276
RA   Wang L., Wang L., Cui S., He X., Ni L., Liu N., Li W., Zhao B., Gong Z.,
RA   Zhang Z., Shan X.;
RT   ;
RL   Submitted (20-JUL-2008) to the INSDC.
RL   HLA Laboratory, Beijing Red Cross Blood Center, No. 37 Beisanhuan Zhonglu,
RL   Beijing 100088, China
XX
DR   MD5; d469614716c1050a47a63f186eb74bf6.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..276
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6q21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>276
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5401N"
FT   mRNA            <1..>276
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5401N"
FT                   /product="MHC class I antigen"
FT   CDS             <1..>276
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5401N"
FT                   /product="MHC class I antigen"
FT                   /db_xref="IMGT/HLA:B*54:16"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:B5B723"
FT                   /protein_id="ACG70199.1"
FT                   /translation="SHTWQTMYGCDLGPDGRLLRGHDQLAYDGKDYIALNEDLSSWTAA
FT                   DTAAQITQRKWEAARVAEQLRAYLEGTCVEWLRRYLENGKETLQRA"
FT   exon            1..276
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5401N"
FT                   /number=3
FT   variation       69
FT                   /gene="HLA-B"
FT                   /replace="a"
FT                   /note="results in aspartic acid to asparagine substitution"
XX
SQ   Sequence 276 BP; 53 A; 83 C; 103 G; 37 T; 0 other;
     ggtctcacac ttggcagacg atgtatggct gcgacctggg gccggacggg cgcctcctcc        60
     gcgggcatga ccagttagcc tacgacggca aggattacat cgccctgaac gaggacctga       120
     gctcctggac cgcggcggac accgcggctc agatcaccca gcgcaagtgg gaggcggccc       180
     gtgtggcgga gcagctgaga gcctacctgg agggcacgtg cgtggagtgg ctccgcagat       240
     acctggagaa cgggaaggag acgctgcagc gcgcgg                                 276
//