spacer

EBI Dbfetch

ID   EU884291; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   EU884291;
XX
DT   11-AUG-2008 (Rel. 96, Created)
DT   07-APR-2013 (Rel. 116, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*1301N allele, exon 2
DE   and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RX   PUBMED; 23216290.
RA   Gong Z., Zhang Z.X., Shan X., Wang L., Liu N.;
RT   "Identification of a new HLA-B*13 allele, HLA-B*13:23";
RL   Tissue Antigens 81(1):53-54(2013).
XX
RN   [2]
RP   1-270
RA   Liu N., Wang L., He X., Li W., Wang L., Ni L., Cui S., Bo T., Gong Z.,
RA   Zhang Z., Shan X.;
RT   "Identification of a Novel HLA-B*1301 Allele in Chinese Stem Cell Donors";
RL   Unpublished.
XX
RN   [3]
RP   1-270
RA   Liu N., Wang L., He X., Li W., Wang L., Ni L., Cui S., Bo T., Gong Z.,
RA   Zhang Z., Shan X.;
RT   ;
RL   Submitted (04-JUL-2008) to the INSDC.
RL   HLA Laboratory, Beijing Red Cross Blood Center, No. 37 Beisanhuan Zhonglu,
RL   Beijing 100088, China
XX
DR   MD5; 9ff3f35e679a19a2c1fa4b7ed8a853ed.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6q21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1301N"
FT   mRNA            <1..>270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1301N"
FT                   /product="MHC class I antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1301N"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:B5B0I4"
FT                   /db_xref="IMGT/HLA:B*13:23"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:B5B0I4"
FT                   /protein_id="ACG55682.1"
FT                   /translation="SHSMRYFHTAMSRPGRGEPRFITVGYVDDTQFVRFDSDATSPRMA
FT                   PRAPWIEQEGPEYWDRETQISKTNTQTYRENLRTALRYYNQSEA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1301N"
FT                   /number=2
FT   variation       24
FT                   /gene="HLA-B"
FT                   /replace="t"
XX
SQ   Sequence 270 BP; 59 A; 93 C; 83 G; 35 T; 0 other;
     gctcccactc catgaggtat ttccacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcac cgtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgcca       120
     cgagtccgag gatggcgccc cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accgggagac acagatctcc aagaccaaca cacagactta ccgagagaac ctgcgcaccg       240
     cgctccgcta ctacaaccag agcgaggccg                                        270
//


spacer
spacer