spacer

EBI Dbfetch

ID   EU873152; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   EU873152;
XX
DT   16-JUL-2008 (Rel. 96, Created)
DT   29-SEP-2010 (Rel. 106, Last updated, Version 3)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB3) gene, HLA-DRB3*01:12 allele,
DE   exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RX   DOI; 10.1111/j.1399-0039.2008.01158.x.
RX   PUBMED; 19000136.
RA   Lee K.W., Jung Y.A.;
RT   "Description of three novel HLA-DRB3 alleles: DRB3*010105, DRB3*0112 and
RT   DRB3*0113";
RL   Tissue Antigens 73(1):83-84(2009).
XX
RN   [2]
RP   1-270
RA   Lee K.W.;
RT   ;
RL   Submitted (07-JUL-2008) to the INSDC.
RL   Hallym Institute for Genome Application, Hallym University, 896
RL   Pyungchon-Dong, Dongan-Gu, Anyang, Kyungki-Do 431-070, Korea
XX
DR   MD5; 467f910f736100f73cf2ec6815791f2f.
DR   Ensembl-Gn; ENSG00000196101; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230463; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231679; homo_sapiens.
DR   Ensembl-Tr; ENST00000307137; homo_sapiens.
DR   Ensembl-Tr; ENST00000383126; homo_sapiens.
DR   Ensembl-Tr; ENST00000426847; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DRB3"
FT                   /allele="HLA-DRB3*01:12"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB3"
FT                   /allele="HLA-DRB3*01:12"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB3"
FT                   /allele="HLA-DRB3*01:12"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:P79483"
FT                   /db_xref="HGNC:HGNC:4951"
FT                   /db_xref="IMGT/HLA:DRB3*01:12"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:2Q6W"
FT                   /db_xref="PDB:3C5J"
FT                   /db_xref="PDB:4H1L"
FT                   /db_xref="UniProtKB/Swiss-Prot:P79483"
FT                   /protein_id="ACF33222.1"
FT                   /translation="RFLELRKSECHFFNGTERVRYLDRYFHNQEEFLRFDSDVGEYRAV
FT                   TELGRPVAESWNSQKDLLEQKRGRVDNYCRHNYRVGESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB3"
FT                   /allele="HLA-DRB3*01:12"
FT                   /number=2
XX
SQ   Sequence 270 BP; 56 A; 66 C; 98 G; 50 T; 0 other;
     cacgtttctt ggagctgcgt aagtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggtacctgga cagatacttc cataaccagg aggagttcct gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgtcgc cgagtcctgg aacagccaga       180
     aggacctcct ggagcagaag cggggccggg tggacaatta ctgcagacac aactaccggg       240
     ttggtgagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer