spacer

EBI Dbfetch

ID   EU871946; SV 1; linear; genomic DNA; STD; HUM; 948 BP.
XX
AC   EU871946;
XX
DT   03-AUG-2008 (Rel. 96, Created)
DT   03-AUG-2008 (Rel. 96, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*46 variant allele,
DE   exons 2, 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-948
RA   Oh H.-B., Kwon O.-J.;
RT   "Novel HLA-B*46 allele variant";
RL   Unpublished.
XX
RN   [2]
RP   1-948
RA   Oh H.-B., Kwon O.-J.;
RT   ;
RL   Submitted (06-JUL-2008) to the INSDC.
RL   Seoul Medical Science Institute, #901-1, ACE Technotower V, 197-22, Guro
RL   3-dong, Guro-gu, Seoul 152-766, Republic of Korea
XX
DR   MD5; d61e10e1b806672d0e991c01d6f1ad2f.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..948
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>948
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*46 variant"
FT   mRNA            join(<71..340,586..>861)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*46 variant"
FT   CDS             join(<71..340,586..>861)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*46 variant"
FT                   /product="MHC class I antigen"
FT                   /note="HLA-B alpha 1 and alpha 2 domain"
FT                   /db_xref="GOA:B5ASL0"
FT                   /db_xref="IMGT/HLA:B*46:17"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:B5ASL0"
FT                   /protein_id="ACF77152.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMA
FT                   PRAPWIEQEGPEYWDRETQKYKRQAQTDRVSLRNLRGYYNQSEAGSHTLQRMYGCDVGP
FT                   DGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAAREAEQWRAYLEGLC
FT                   VESLRRYLENGKETLQRA"
FT   exon            71..340
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*46 variant"
FT                   /number=2
FT   exon            586..861
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*46 variant"
FT                   /number=3
XX
SQ   Sequence 948 BP; 166 A; 312 C; 350 G; 120 T; 0 other;
     gggggcgcag gacccgggga gccgcgccgg gaggagggtc gggcgggtct cagcccctcc        60
     tcgcccccag gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc       120
     ggggagcccc gcttcatcgc agtgggctac gtggacgaca cccagttcgt gaggttcgac       180
     agcgacgccg cgagtccgag gatggcgccc cgggcgccat ggatagagca ggaggggccg       240
     gagtattggg accgggagac acagaagtac aagcgccagg cacagactga ccgagtgagc       300
     ctgcggaacc tgcgcggcta ctacaaccag agcgaggccg gtgagtgacc ccggcctggg       360
     gcgcaggtca cgactcccca tcccccacgt acggcccggg tcgccccgag tctccgggtc       420
     cgagatccgc ccccctgagg ccgcgggacc cgcccaaacc ctcgaccggc gagagcccca       480
     ggcgcgttta cccggtttca ttttcagttg aggccaaaat ccccgcgggt tggtcggggc       540
     ggggcggggc tcgggggacg gggctgaccg cggggcctgg gccagggtct cacaccctcc       600
     agaggatgta cggctgcgac gtggggccgg acgggcgcct cctccgcggg catgaccagt       660
     ccgcctacga cggcaaggat tacatcgccc tgaacgagga cctgagctcc tggaccgcgg       720
     cggacacggc ggctcagatc acccagcgca agtgggaggc ggcccgtgag gcggagcagt       780
     ggagagccta cctggagggc ctgtgcgtgg agtcgctccg cagatacctg gagaacggga       840
     aggagacgct gcagcgcgcg ggtaccaggg gcagtgggga gccttcccca tctcctatag       900
     gtcgccgggg atggcctccc acgagaagag gaggaaaatg ggatcagc                    948
//


spacer
spacer