spacer

EBI Dbfetch

ID   EU862819; SV 1; linear; genomic DNA; STD; HUM; 276 BP.
XX
AC   EU862819;
XX
DT   30-JUL-2008 (Rel. 96, Created)
DT   30-JUL-2008 (Rel. 96, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, exon 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-276
RA   Cui S., Shan X., He X., Liu N., Wang L., Li W., Wang L., Ni L., Wang D.,
RA   Zhao B., Gong Z., Zhang Z.;
RT   "Identified a novel allele by SBT";
RL   Unpublished.
XX
RN   [2]
RP   1-276
RA   Cui S., Shan X., He X., Liu N., Wang L., Li W., Wang L., Ni L., Wang D.,
RA   Zhao B., Gong Z., Zhang Z.;
RT   ;
RL   Submitted (22-JUN-2008) to the INSDC.
RL   HLA Lab, Beijing Red Cross Blood Center, 37 North Third Ring Road, Beijing
RL   100088, China
XX
DR   MD5; b0aedeb6bd39c9f5a0ac50aa7bff225d.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..276
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>276
FT                   /gene="HLA-A"
FT   mRNA            <1..>276
FT                   /gene="HLA-A"
FT                   /product="MHC class I antigen"
FT   CDS             <1..>276
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:B5AN67"
FT                   /db_xref="IMGT/HLA:A*24:92"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:B5AN67"
FT                   /protein_id="ACF70727.1"
FT                   /translation="SHTIQIMYGCDVGPDGRFLRGYHQYAYDGKDYIALKEDLRSWTAA
FT                   DMAAQITKRKWEAAHVAEQQRAYLEGTCVDGLRRYLENGKETLQRT"
FT   exon            1..276
FT                   /gene="HLA-A"
FT                   /number=3
FT   variation       12
FT                   /gene="HLA-A"
FT                   /replace="c"
FT                   /note="I95L; compared with HLA-A*24020101"
FT   variation       20
FT                   /gene="HLA-A"
FT                   /replace="g"
FT                   /note="I97M; compared with HLA-A*24020101"
FT   variation       25
FT                   /gene="HLA-A"
FT                   /replace="t"
FT                   /note="Y99F; compared with HLA-A*24020101"
FT   variation       42
FT                   /gene="HLA-A"
FT                   /replace="t"
FT                   /note="P105S; compared with HLA-A*24020101"
XX
SQ   Sequence 276 BP; 59 A; 81 C; 98 G; 38 T; 0 other;
     gttctcacac catccagata atgtatggct gcgacgtggg gccggacggg cgcttcctcc        60
     gcgggtacca ccagtacgcc tacgacggca aggattacat cgccctgaaa gaggacctgc       120
     gctcttggac cgcggcggac atggcggctc agatcaccaa gcgcaagtgg gaggcggccc       180
     atgtggcgga gcagcagaga gcctacctgg agggcacgtg cgtggacggg ctccgcagat       240
     acctggagaa cgggaaggag acgctgcagc gcacgg                                 276
//


spacer
spacer