spacer

EBI Dbfetch

ID   EU839991; SV 1; linear; genomic DNA; STD; HUM; 1168 BP.
XX
AC   EU839991;
XX
DT   08-JUL-2008 (Rel. 96, Created)
DT   23-MAR-2009 (Rel. 100, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*51 novel allele, exons
DE   1 through 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1168
RX   DOI; 10.1111/j.1399-0039.2009.01221.x.
RX   PUBMED; 19317751.
RA   Roh E.Y., Shin S., Yoon J.H., Ahn B.M., Chang J.Y.;
RT   "A new HLA-B*51 variant, B*5158, identified by sequence-based typing in a
RT   Korean individual";
RL   Tissue Antigens 73(4):375-376(2009).
XX
RN   [2]
RP   1-1168
RA   Jang J.Y., Lee J.H., Roh E.Y.;
RT   "A novel HLA-B*51 allele, identified by sequence-based typing";
RL   Unpublished.
XX
RN   [3]
RP   1-1168
RA   Ahn B.M.;
RT   ;
RL   Submitted (04-JUN-2008) to the INSDC.
RL   Woongbee Meditech, Rm 1309 Biz Center 190-1 Sangdaewon-1 Dong, Jungwon-Ku,
RL   Seongnam, Kyunggi-Do 462-721, Rep. of Korea
XX
RN   [4]
RP   1-1168
RA   Jang J.Y., Lee J.H.;
RT   ;
RL   Submitted (02-JUL-2008) to the INSDC.
RL   AllCORD, Seoul Metropolitan Public CORD Blood Bank, Seoul National
RL   University Boramae Hospital, 425, Shindaebang-Dong, Dongjak-Gu, Seoul
RL   156-707, Rep. of Korea
XX
RN   [5]
RP   1-1168
RA   Roh E.Y.;
RT   ;
RL   Submitted (02-JUL-2008) to the INSDC.
RL   Dept. of Laboratory Medicine, National University Boramae Hospital, 425,
RL   Shindaebang-Dong, Dongjak-Gu, Seoul 156-707, Rep. of Korea
XX
DR   MD5; ab135d226ec282e025140c8eaf719b02.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1168
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>975
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*51 novel"
FT   mRNA            join(<1..55,185..454,700..>975)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*51 novel"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..55,185..454,700..>975)
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*51 novel"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:B3W4E3"
FT                   /db_xref="IMGT/HLA:B*51:58"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:B3W4E3"
FT                   /protein_id="ACF20360.1"
FT                   /translation="RTVLLLLWGAVALTETWAGSHSMRYFYTAMSRPGRGEPRFIAVGY
FT                   VDDTQFVRFDSDAASPRTEPWAPWIEQEGPEYWDRNTQIFKTNTQTYRENLRIALRYYN
FT                   QSEAGSHTWQTMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLSSWTAADTAAQITQR
FT                   KWEAAREAEQLRAYLEGLCVEWLRRHLENGKETLQRA"
FT   exon            <1..55
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*51 novel"
FT                   /number=1
FT   exon            185..454
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*51 novel"
FT                   /number=2
FT   exon            700..975
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*51 novel"
FT                   /number=3
XX
SQ   Sequence 1168 BP; 210 A; 367 C; 418 G; 173 T; 0 other;
     cgaaccgtcc tcctgctgct ctggggggca gtggccctga ccgagacctg ggccggtgag        60
     tgcggggtcg ggagggaaat ggcctctgtg gggaggagcg aggggaccgc aggcgggggc       120
     gcaggacctg aggagccgcg ccgggaggag ggtcgggcgg gtctcagccc ctcctcgccc       180
     ccaggctccc actccatgag gtatttctac accgccatgt cccggcccgg ccgcggggag       240
     ccccgcttca ttgcagtggg ctacgtggac gacacccagt tcgtgaggtt cgacagcgac       300
     gccgcgagtc cgaggacgga gccctgggcg ccatggatag agcaggaggg gccggagtat       360
     tgggaccgga acacacagat cttcaagacc aacacacaga cttaccgaga gaacctgcgg       420
     atcgcgctcc gctactacaa ccagagcgag gccggtgagt gaccccggcc cggggcgcag       480
     gtcacgactc cccatccccc acgtacggcc cgggtcgccc cgagtctccg ggtccgagat       540
     ccgcctccct gaggccgcgg gacccgccca gaccctcgac cggcgagagc cccaggcgcg       600
     tttacccggt ttcattttca gttgaggcca aaatccccgc gggttggtcg gggcggggcg       660
     gggctcgggg gacggtgctg accgcggggc cggggccagg gtctcacact tggcagacga       720
     tgtatggctg cgacgtgggg ccggacgggc gcctcctccg cgggcataac cagtacgcct       780
     acgacggcaa agattacatc gccctgaacg aggacctgag ctcctggacc gcggcggaca       840
     ccgcggctca gatcacccag cgcaagtggg aggcggcccg tgaggcggag cagctgagag       900
     cctacctgga gggcctgtgc gtggagtggc tccgcagaca cctggagaac gggaaggaga       960
     cgctgcagcg cgcgggtacc aggggcagtg gggagccttc cccatctcct ataggtcgcc      1020
     ggggatggcc tcccacgaga agaggaggaa aatgggatca gcgctagaat gtcgccctcc      1080
     cttgaatgga gaatggcatg agttttcctg agtttcctct gagggccccc tcttctctct      1140
     aggacaatta agggatgacg tctctgag                                         1168
//


spacer
spacer