spacer

EBI Dbfetch

ID   EU827505; SV 1; linear; genomic DNA; STD; HUM; 1845 BP.
XX
AC   EU827505;
XX
DT   18-AUG-2008 (Rel. 96, Created)
DT   18-AUG-2008 (Rel. 96, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*2428 variant allele,
DE   exons 1 through 4 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1845
RA   Lazaro A.M., Xiao Y., Hurley C.K.;
RT   ;
RL   Submitted (17-JUN-2008) to the INSDC.
RL   Oncology, Georgetown University, 3970 Reservoir Rd, N.W., Washington, DC
RL   20057, USA
XX
DR   MD5; 19503ab52d3a9536ed31b67d5b7e33c1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1845
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1845
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2428 variant"
FT   mRNA            join(<1..73,204..473,715..990,1570..>1845)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2428 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(1..73,204..473,715..990,1570..>1845)
FT                   /codon_start=1
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2428 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:B5A9M9"
FT                   /db_xref="IMGT/HLA:A*33:19"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:B5A9M9"
FT                   /protein_id="ACG64188.1"
FT                   /translation="MAVMAPRTLLLLLLGALALTQTWAGSHSMRYFTTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDRNTRNVKAHSQIDRVDLGT
FT                   LRGYYNQSEAGSHTLQMMFGCDVGSDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMA
FT                   AQITKRKWEAAHVAEQQRAYLEGTCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRW"
FT   exon            <1..73
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2428 variant"
FT                   /number=1
FT   gap             74..203
FT                   /estimated_length=130
FT   exon            204..473
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2428 variant"
FT                   /number=2
FT   gap             474..714
FT                   /estimated_length=241
FT   exon            715..990
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2428 variant"
FT                   /number=3
FT   gap             991..1569
FT                   /estimated_length=579
FT   exon            1570..>1845
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2428 variant"
FT                   /number=4
XX
SQ   Sequence 1845 BP; 179 A; 281 C; 301 G; 134 T; 950 other;
     atggccgtca tggcgccccg aaccctcctc ctgctactct tgggggccct ggccctgacc        60
     cagacctggg cggnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       120
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       180
     nnnnnnnnnn nnnnnnnnnn nnngctccca ctccatgagg tatttcacca catccgtgtc       240
     ccggcccggc cgcggggagc cccgcttcat cgccgtgggc tacgtggacg acacgcagtt       300
     cgtgcggttc gacagcgacg ccgcgagcca gaggatggag ccgcgggcgc cgtggataga       360
     gcaggagggg ccggagtatt gggaccggaa cacacggaat gtgaaggccc actcacagat       420
     tgaccgagtg gacctgggga ccctgcgcgg ctactacaac cagagcgagg ccgnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       540
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       600
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       660
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnngttctc       720
     acaccctcca gatgatgttt ggctgcgacg tggggtcgga cgggcgcttc ctccgcgggt       780
     accaccagta cgcctacgac ggcaaggatt acatcgccct gaaagaggac ctgcgctctt       840
     ggaccgcggc ggacatggcg gctcagatca ccaagcgcaa gtgggaggcg gcccatgtgg       900
     cggagcagca gagagcctac ctggagggca cgtgcgtgga cgggctccgc agatacctgg       960
     agaacgggaa ggagacgctg cagcgcacgg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1020
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1080
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1140
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1200
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1260
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1320
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1380
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1440
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1500
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1560
     nnnnnnnnna cccccccaag acacatatga cccaccaccc catctctgac catgaggcca      1620
     ctctgagatg ctgggccctg ggcttctacc ctgcggagat cacactgacc tggcagcggg      1680
     atggggagga ccagacccag gacacggagc ttgtggagac caggcctgca ggggatggaa      1740
     ccttccagaa gtgggcagct gtggtggtac cttctggaga ggagcagaga tacacctgcc      1800
     atgtgcagca tgagggtctg cccaagcccc tcaccctgag atggg                      1845
//


spacer
spacer